KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_00878Help
Entry
MIP_00878         CDS       T02325                                 

Definition
(GenBank) Cell division protease ftsH -like protein
  KO
K03798  cell division protease FtsH [EC:3.4.24.-]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Brite
KEGG Orthology (KO) [BR:mid00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mid01002]
    MIP_00878
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mid03110]
    MIP_00878
Enzymes [BR:mid01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     MIP_00878
Peptidases and inhibitors [BR:mid01002]
 Metallo peptidases
  Family M41: FtsH endopeptidase family
   MIP_00878
Chaperones and folding catalysts [BR:mid03110]
 Other chaperones and cochaperones
  AAA proteases
   MIP_00878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M41 AAA AAA_lid_3 FtsH_ext AAA_5 AAA_16 RuvB_N TIP49 AAA_22 AAA_33 Mg_chelatase IstB_IS21 AAA_24 RNA_helicase TsaE AAA_28 AAA_18 AAA_17 AAA_2
Motif
Other DBs
NCBI-ProteinID: AFS12598
UniProt: J9W936
LinkDB All DBs
Position
634242..636674
Genome map
AA seq 810 aa AA seqDB search
MNRKNVIRTITAIAVVVLLGWSFFYFSDDTRGYKPVDTSVAMSQINGDNVKSAQIDDREQ
QLRLTLKKGNGDTDNSDKVITKYPSGYAVDLFNALTAKNAKVSTVVNQGSILGELLVYVL
PLLLLVGLFVMFSRMQGGARMGFGFGKSRAKQLSKDMPKTTFADVAGVDEAVEELYEIKD
FLQNPGRYQALGAKIPRGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVG
ASRVRDLFDQAKQNNPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFDPRA
GVILIAATNRPDILDPALLRPGRFDRQIPVSNPDLAGRKAVLEVHSKGKPIGPDADLAGL
AKRTVGMTGADLANVINEAALLTARENGTVITSAALEEAVDRVIGGPRRKGRIISEQEKK
ITAYHEGGHTLAAWAMPDIEPIYKVTILARGRTGGHAVAVPEEDKGLRTRSEMIAQLVFA
MGGRAAEELVFREPTTGAVSDIEQATKIARAMVTEFGMSSKLGAVKYGSEHGDPFLGRTM
GTQADYSHEVARDIDDEIRKLIEAAHTEAWEILTEYRDILDTLAGELLEKETLHRAELES
IFSGVEKRPRLTMFDDFGGRIPSDKPPIKTPGELAIERGEPWPPPTPEPAFKAAIARASE
AARLEADRNANGGNGSHGGQASGKGAPHGPTQPDYGAPAGWRAPGWPPQAQQPQQQPNYW
HPPAQPPQQPYWQQPAPSYPGPQPYPGQQGHAGHQQGYPGGQGRSGQQGQAQPSYPPYPP
YPPPGQPAQEGGSPDRQDDDVSRSNPPAHG
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaaaacgttattcgcaccatcacggcgattgctgtcgtggtgctgctcggc
tggtcgttcttctatttcagcgacgacactcgcggctataagcccgtcgacacgtccgtg
gcgatgtcccagatcaacggcgacaacgtcaaaagcgcgcaaatcgacgatcgcgagcag
cagctgcgcctgaccctgaagaagggcaatggcgacacggacaactccgacaaggtcatc
accaaatacccgagcgggtatgcggtcgacctcttcaacgcgctgaccgccaagaacgcg
aaggtcagcaccgtcgtcaaccagggcagcatcctgggcgagctgctggtctacgtcctg
ccgctgctgctgctggtcgggctgttcgtgatgttctcccgcatgcagggcggcgcccgg
atgggcttcgggttcggcaaatcgcgcgccaagcagctctccaaggacatgcccaagacc
acgttcgccgacgtcgccggcgtcgacgaggcggtcgaggagctttacgagatcaaggac
ttcctgcagaaccccggtcgctatcaggcgctgggcgccaagatcccccggggcgtgctg
ctctacggtccgcccgggaccgggaagacgctgctcgcccgcgcggtggcgggcgaggcc
ggcgtcccgttcttcaccatctccggctcagacttcgtcgagatgttcgtcggtgtcggt
gcgtcccgggtacgcgacctgttcgaccaggccaaacagaacaacccgtgcatcatcttc
gtcgatgagatcgacgccgttggccgccagcgcggcgcgggcctgggcggcgggcacgac
gagcgcgagcagacgctgaaccagttgctggtcgaaatggacgggttcgacccgcgggcc
ggcgtgatcctgatcgcggccaccaaccggcccgacatcctggacccggcgctgctgcgg
cccggccgcttcgaccggcagatcccggtgtccaacccggacctggcgggccgcaaggcg
gtgctggaggtgcactccaagggcaagccgatcggcccggatgccgacctcgccgggctg
gccaagcggaccgtcggcatgaccggcgccgacctggccaacgtcatcaacgaggcggcg
ttgctcacggcccgggagaacggcaccgtcatcaccagcgccgccctggaagaggcggtg
gaccgggtgatcggcggcccgcgccgcaagggccgcatcatcagcgagcaggaaaagaag
atcaccgcctaccacgaaggcggccacaccctggcggcctgggcgatgcccgacatcgag
ccgatctacaaggtgacgatcctggcgcgaggccgcaccggcgggcacgcggtggcggtg
ccggaggaagacaaggggctgcggacccgctcggagatgatcgcgcagttggtgtttgcc
atgggcgggcgcgccgcggaggagctggtcttccgggagccgaccaccggcgcggtgtcg
gacatcgagcaggccaccaagatcgcgcgtgccatggtcaccgaattcgggatgagctcc
aaactcggtgcggtcaaatacggttcggaacacggcgacccgttcctgggccgcaccatg
ggaacgcaggcggactattcgcacgaggtcgcccgcgacatcgacgacgagatccgcaag
ctgatcgaggccgcgcacaccgaggcgtgggaaatcctcaccgaataccgcgacatcctc
gacaccctcgccggcgagctgctggaaaaggaaaccctgcaccgggccgaactggaaagc
atcttctcgggcgtcgaaaagcgcccgcggctcaccatgttcgacgatttcggtggccgc
atcccgtcggacaagccgcccatcaagacccccggcgagctggccatcgagcgtggcgag
ccgtggccgccgcccacgcccgagccggcgttcaaggcggccatcgcgcgggccagcgaa
gcggcacggctggaggccgaccgaaacgccaacggcggcaacggttctcatggcggccag
gccagcggtaagggcgcgccgcacgggcccacccagccggactacggcgcgccggcgggc
tggcgcgcgccgggatggccgccgcaagcgcagcaaccgcagcagcagccgaactattgg
catccgccggcgcagccgccacagcagccctattggcagcaaccggcgcccagttatccg
ggcccgcagccctatcccggtcagcagggccacgccggccaccagcagggctatccgggc
gggcagggtcgttccggccagcagggccaggcgcagccgtcgtacccgccgtacccgccg
tatcccccaccgggacagcccgcccaggagggtggctcgcccgaccggcaggatgacgac
gtgagccggtccaatccgccggcccacggctga

DBGET integrated database retrieval system