KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_04736Help
Entry
MIP_04736         CDS       T02325                                 

Definition
(GenBank) Transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00030  Pentose phosphate pathway
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01130  Biosynthesis of antibiotics
mid01200  Carbon metabolism
mid01230  Biosynthesis of amino acids
Module
mid_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mid_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MIP_04736
Enzymes [BR:mid01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     MIP_04736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA Rubella_E2
Motif
Other DBs
NCBI-ProteinID: AFS15202
UniProt: J9WKY2
LinkDB All DBs
Position
3538826..3539953
Genome map
AA seq 375 aa AA seqDB search
MTQDPTLTALSAAGVSVWLDDLSRDRLVSGNLQRLIDTRSVVGVTTNPSIFQRAISHGHA
YDRQITELAEGGADAESAIRTVITDDVRQACDVLRPQWEASGGVDGRVSIEVDPRAAHDA
DKTVSQAVELWKIVDRPNLFIKIPATSAGMSAITATVAEGISVNVTLIFSVERHRAVMNA
YLAGLEAAQRAGKDLTQIHSVASLFVSRIDTEIDQRLETIGTEAAMELRGRAGIATARLA
YAAYQEVFQAGHRYAALGYDGAHVQRPLWASTGVKNPAYPDTMYITELVAPHTVSTIPEK
TLEALADHGVISGDSITGTAADARAVLDNISAAGVELKDVVRTLEDDGVAKFVASWRQLL
GSYPAPPNLLPKGHQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagacccaaccctgaccgcgctttcggcggcgggggtctcggtttggttggac
gacctgtcccgcgaccgtctggtatccggcaacctgcagaggctgatcgacaccagaagc
gtagtcggcgtcaccaccaatccctcgatcttccagcgggcgatctcacatggccatgcc
tacgatcggcagatcaccgaactggccgaaggcggcgccgacgccgaatcggcgatccgc
accgtcatcaccgacgacgtccggcaagcgtgcgacgtcctgcgcccgcagtgggaagcc
tccggtggcgtcgacggacgggtatccatcgaggtggacccgagggcagcccacgacgcc
gacaagacggtcagtcaagccgtcgagttgtggaagatcgtcgatcggccgaatctgttc
atcaagatccccgcgacgtcggccggtatgtccgcgatcaccgccactgtggccgagggc
atttcagtcaacgtgaccctcatcttctcggtcgagcgccatcgtgcggtgatgaacgcc
tacctggccgggctggaggcggcgcagcgcgccggcaaagacctcacccaaatccattcc
gtggcatccctgttcgtctcccgcatcgacaccgagatcgaccagcggctggagacgatc
ggcaccgaggcagccatggaactgcgcggacgtgccggaatcgccaccgcccggctcgct
tatgccgcataccaggaggtgttccaagccggacaccgctacgccgcgctcggctacgac
ggcgcccatgtgcagcgcccgctgtgggcctccaccggggtgaaaaaccccgcctatccc
gacaccatgtacatcaccgagctggtcgcaccacacactgtcagcaccatcccggaaaaa
accttggaggcacttgccgatcatggcgtgatcagcggcgactccatcaccgggacggcc
gccgacgcccgagccgtgctcgacaacatcagcgcagccggcgtggaactcaaggacgtt
gtgaggacgctcgaagatgacggcgtcgccaaattcgtagcatcctggcggcaactgctc
gggtcctatcccgctcccccaaatctgctgccaaaaggacaccaatga

KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_04772Help
Entry
MIP_04772         CDS       T02325                                 

Definition
(GenBank) Transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00030  Pentose phosphate pathway
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01130  Biosynthesis of antibiotics
mid01200  Carbon metabolism
mid01230  Biosynthesis of amino acids
Module
mid_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mid_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MIP_04772
Enzymes [BR:mid01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     MIP_04772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-ProteinID: AFS15230
UniProt: J9WDX8
LinkDB All DBs
Position
3565537..3566658
Genome map
AA seq 373 aa AA seqDB search
MTAQNPNLAALSAAGVSVWLDDLSRERLRSGNLQELIDTKSVVGVTTNPSIFQKAFAEGD
AYDSQIAELAERGADVDATIRTVTTDDVRNACDVLTREWENSDGVDGRVSIEVDPRLAGD
TDKTIAQAVELWKIVDRPNLFIKIPATEAGIPAITAVLAEGISVNVTLIFSVERYRAVMD
AYLAGMEKAREGGHDLSKIHSVASFFVSRVDTEVDKRLEKIGSEDAKALLGQAGVANARL
AYAAYQEVFEGGERYQALKAHGARVQRPLWASTGVKNPDYSDTLYVTELVAPNTVNTMPE
KTIDAVADHGVIKGDTVTGTAADAQQVFDKLDQIGIDLSDVFVVLEDEGVEKFVDSWTEL
LEETQKQLGSASK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcagaaccctaacctcgcggcgctgagcgccgcgggcgtttccgtgtggctc
gacgacctgtcgcgggagcggcttcggtcggggaacctgcaggagctcatcgacaccaag
agcgtcgtcggcgtgaccaccaacccgtcgatcttccagaaggcgttcgccgagggcgat
gcctacgacagccagatcgccgagctcgccgagcgcggcgccgacgtcgacgccaccatc
cgcaccgtcaccaccgacgacgtgcgcaacgcgtgcgacgtgttgacgcgcgagtgggag
aactccgacggcgtcgacggccgggtgtccatcgaggtcgacccccggctggcgggcgac
accgacaagaccatcgctcaggccgtcgagctgtggaagatcgtcgaccggccgaacctg
ttcatcaagatcccggcgaccgaggccgggattccggccatcaccgccgttctggcggaa
gggatttcggtcaatgtcacgctgatcttctccgtcgagcggtaccgggccgtgatggac
gcctacctggccggcatggagaaggcccgcgaaggcggacacgacctgtccaagatccat
tcggtggcttcgttcttcgtctcccgggtggacaccgaggtcgacaagcggctggagaag
atcgggtccgaggacgccaaggcgctgctgggccaggccggtgtggccaacgcccggctg
gcctacgcggcctaccaggaggtgttcgaaggcggcgagcgttaccaggcgctcaaggcc
cacggggcccgggtgcagcgtccgctctgggcgtcgaccggggtcaagaaccccgactac
tccgacaccctctatgtcaccgaactggtggcgcccaacacggtgaacaccatgccggag
aagacaattgacgcggtcgccgatcacggtgtgatcaagggcgacaccgtcaccggcacc
gccgcggacgcccagcaggtgttcgacaagctggaccagatcggcatcgatctgagcgac
gtcttcgtggtgctcgaagacgagggggtggagaagttcgtggattcgtggaccgagctg
ctggaggaaacgcagaagcagctgggttccgcctccaaatga

DBGET integrated database retrieval system