KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_05518Help
Entry
MIP_05518         CDS       T02325                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00473  D-Alanine metabolism
mid00550  Peptidoglycan biosynthesis
mid01100  Metabolic pathways
mid01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mid00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MIP_05518
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MIP_05518
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MIP_05518
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mid01011]
    MIP_05518
Enzymes [BR:mid01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MIP_05518
Peptidoglycan biosynthesis and degradation proteins [BR:mid01011]
 Precursor biosynthesis
  Amino acid ligase
   MIP_05518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 RimK CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AFS15716
UniProt: J9WK82
LinkDB All DBs
Position
complement(4034518..4035663)
Genome map
AA seq 381 aa AA seqDB search
MNASDRSTPRPGSGGGERARVAVVFGGRSNEHAISCVSAGSILRNLDPERFEVVAIGITP
EGSWVLTDGDPAALAITDRRLPEVTAESGTELALSADPRRGGQLVALPPGAGEVLASVDV
VFPVLHGPYGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLFAAEGLPVGDYAVL
RPSRARLRPEECQRLGLPVFVKPARGGSSIGVSRVASWDQLDAAVAAARRHDPKVIVEAA
IVGRELECGVLEMPDGTVEASALGEIRVAGVRGREDSFYDFATKYLDDAAELDVPAKVDD
EIADTVRQLAVRAFKAIDCQGLARVDFFLTEDGPVLNEINTMPGFTTISMYPRMWAASGV
DYPTLLATMVETALARGVGLR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgccagcgatcggtcgacgccgcgccccggctcggggggcggcgagcgggcgcgc
gtggccgtcgtcttcggggggcgcagcaacgagcacgccatctcgtgcgtctcggcgggc
agcattctgcgcaacctcgaccccgagcgtttcgaggtggtcgcgatcggcatcaccccg
gaaggttcctgggtgctcaccgacggcgacccggccgcgctggcgatcaccgaccggcgg
ctgcccgaagtcaccgccgagtcgggaaccgaactggcgctgtcggccgatccgcggcgc
ggcggccaattggtcgccctgccgcccggcgccggtgaggtgttggcgtccgtcgacgtg
gtgttccccgtgctgcacggcccctacggcgaggacggcaccatccagggtctgctcgaa
ctcgccggcgtgccgtatgtgggggccggtgtgctggccagcgccgccggcatggacaag
gagttcaccaagaagctgttcgccgccgagggattgccggtcggcgactacgcggtgctg
cgcccctcgcgcgcgcggctgcggcccgaggagtgccagcggctggggctgccggtgttc
gtcaaacccgcccggggaggttcctcgatcggtgtgagccgggtagcgagctgggaccag
ctggacgccgccgtcgccgcggcgcgccgccacgatcccaaagtcatcgtcgaggccgcg
atcgtcggccgcgagctggagtgcggtgtgctcgaaatgcccgacggcacagtcgaagcc
agcgcgctcggcgagatccgggtggccggcgtgcggggccgcgaggattcgttctacgac
ttcgccaccaaataccttgacgacgcagccgaattggacgtgcccgcaaaggtcgacgac
gaaatcgccgacacagtgcgccaattggcggtccgcgccttcaaggccatcgactgccag
ggtctggcgcgggtggatttcttcctcaccgaggacgggccggtgctcaacgagatcaac
acgatgccggggttcaccacgatctcgatgtacccgcggatgtgggcggccagcggcgtg
gactacccgaccctgctggcgacgatggtcgagacggcgctggcccgcggggtgggcctg
cgctag

DBGET integrated database retrieval system