KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_07290Help
Entry
MIP_07290         CDS       T02325                                 

Definition
(GenBank) Fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00020  Citrate cycle (TCA cycle)
mid00190  Oxidative phosphorylation
mid00650  Butanoate metabolism
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01130  Biosynthesis of antibiotics
mid01200  Carbon metabolism
Module
mid_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mid_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mid_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MIP_07290
   00650 Butanoate metabolism
    MIP_07290
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MIP_07290
Enzymes [BR:mid01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MIP_07290
    1.3.5.4  fumarate reductase (quinol)
     MIP_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_18 Fer4_17 Fer4_9 Fer4_7 Fer4_16 Thioredoxin_7 Fer4_10
Motif
Other DBs
NCBI-ProteinID: AFS16900
UniProt: J9WIT9
LinkDB All DBs
Position
5230065..5230811
Genome map
AA seq 248 aa AA seqDB search
MTYNATMRVWRGDDANGALQDFTVEVNEGEVVLDIIHRLQQTQTPDLAVRWNCKAGKCGS
CSAEINGYPRLLCMTRMSTFAEDEVVTVTPLRTFPVIRDLVTDVSFNYEKAREIPSFAPP
KDLQPGEYRMAQEDVQRSQEFRKCIECFLCQNVCHVVRDHEENKKAFAGPRFLMRIAELE
MHPLDTRDRRKDAQEEHGLGYCNITKCCTEVCPENIKITDNALIPMKERVADRKYDPVVW
LGNKLFRR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaacgcgacgatgcgggtgtggcgcggcgacgacgccaacggtgcgttgcag
gacttcaccgtcgaggtcaacgagggtgaggttgtcctcgacatcatccaccgcctgcag
cagacccagacgcccgacctggcggtccggtggaactgcaaggcgggcaagtgcggctcg
tgctccgcggagatcaacggctatccgcggttgctctgcatgacccggatgtccacgttc
gccgaggacgaggtcgtcacggtcacgccgctgcggacgttcccggtgatccgggacctg
gtcaccgacgtctcgttcaactacgagaaggcccgcgagataccgtctttcgcgccgccc
aaggacctgcaacccggcgagtaccggatggcgcaggaggacgtccagcgctcccaagag
ttccgcaagtgcatcgagtgcttcctgtgccagaacgtgtgccacgtggtccgcgaccac
gaggagaacaagaaggcgttcgccggcccccgcttcctgatgcggatcgccgagctggag
atgcaccccctggacacccgggaccggcgcaaggacgcccaggaagagcacggcctgggg
tactgcaacatcaccaagtgctgcaccgaggtctgcccggagaacatcaagatcaccgac
aacgcgctgatcccgatgaaggagcgcgtcgccgaccgcaagtacgacccggtggtctgg
ctcggtaacaagctgttccgtcgctga

DBGET integrated database retrieval system