KEGG   Mycobacterium intracellulare 1956: LG41_14150Help
Entry
LG41_14150        CDS       T03407                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mie  Mycobacterium intracellulare 1956
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AIT86003
UniProt: X8CFR3
LinkDB All DBs
Position
3036211..3037209
Genome map
AA seq 332 aa AA seqDB search
MTDFASLPGAVREALYDEPVPDWRSPTLATLTDDRFSDPGWIFERKFDGMRCLAFRDGDR
VRLLSRNRQPLNGTYPELVDALAAQPVTRFVVDGEVVAFDGRRTSFARLQGRLGLTDPDV
ARASPVRVFYYVFDLLHLDGMSTVEVPLLWRKRLLRKAIDFADPLRCAPHRVGDGIAAYR
RACERGDEGVIAKRADSTYQGGRSKNWLKFKCVRDQEFVVGGYTSPKGSRVELGALMLGY
YDGGDLVYAGKVGTGFDDATLRRLHARLSPITRDRPPFARGLVREAGANWVSPEMVVQIG
FSEWTRDGKLRHPRYLGMRTDKEPGEVVRETH
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacggacttcgcgagcctgcccggtgcggtgcgcgaagcgctgtacgacgaacccgtg
cccgactggcgctcgcccaccctggccaccctcaccgacgaccggttctccgatccgggc
tggatcttcgagcgcaagttcgacggcatgcgctgcctggcgttccgcgacggcgatcgg
gtccggctgttgtcgcgtaatcgtcagccgctcaatggaacctatcccgaattggtggat
gcgcttgccgcgcaaccggtcacgcggttcgtcgtggacggagaggtggtggccttcgac
ggccggcggaccagcttcgcccggctgcagggtcggctgggcctcaccgaccccgacgtg
gcccgggcgtcgccggtgcgtgtcttctactacgtattcgatctgctgcatctcgacggc
atgtccaccgtcgaggtgccgctcctctggcgaaagaggttgctgcgcaaagcgatcgac
ttcgccgacccgctgcgctgtgcaccgcaccgcgtcggggacgggatcgccgcctaccgg
cgcgcatgtgagcgcggggacgagggagtgatcgccaagcgggccgactccacctaccag
ggcggtcgctcgaaaaactggctgaagttcaaatgcgtgcgcgatcaggagttcgtggtg
gggggctacaccagtcccaagggcagtcgagtcgagttgggcgccctgatgctcggctac
tacgacggcggggacctggtctacgcgggcaaggtcggcaccggtttcgacgacgccacg
ctgcgccggctgcacgcgcgcctgtcgccgatcacccgggacaggccgccgttcgcccgc
ggtttggtgcgcgaggccggcgcgaactgggtatcccccgagatggtggttcagatcgga
ttcagcgagtggacgcgtgatggcaagttgcgccatccgcgctacctcggcatgcgcacc
gacaaggagcccggcgaagtggtgcgggagacgcactga

DBGET integrated database retrieval system