KEGG   Mycobacterium intracellulare 1956: LG41_14155Help
Entry
LG41_14155        CDS       T03407                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mie  Mycobacterium intracellulare 1956
Pathway
mie03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mie00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    LG41_14155
Enzymes [BR:mie01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LG41_14155
DNA repair and recombination proteins [BR:mie03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     LG41_14155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S Alpha_TIF
Motif
Other DBs
NCBI-ProteinID: AIT86004
LinkDB All DBs
Position
3037209..3038099
Genome map
AA seq 296 aa AA seqDB search
MARVDVEITHPDRVLFPADGITKRDLAAYYDQVADTMLTHLRGRALNVQRYPRGIAETGF
IQQDFADSLPDWMSSVRVAKEGGTVEHPVVERPEALRWLANQSCITLHMWQSRRARLDHP
DRLVFDLDPSDGDFAVVRATARATAGVLGDLGLACYVQTTGSRGLHVVAPLRADTDFDTA
RQFARDVSEVVAADDPAHRTVEARKDKRDGRVYLDIMRNAYAQTAVAPYSVRARNGAPVA
TPLEWDELDAGRLRADRFTIRDVPKRLAGQPDPWAHMSRHARSLAGPLRRLARLRA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgtcgacgtcgagatcacccacccggaccgcgtcctgtttcccgccgacggg
atcacgaaacgcgatctcgccgcctattacgaccaggtggccgacaccatgttgacgcac
ctgcggggccgggccctcaacgtgcagcgctatccccgcggcatcgccgaaacagggttc
atccagcaggatttcgccgattcgctaccagactggatgagcagtgtccgggtggccaag
gagggcggcaccgtagagcatccggtcgtcgaacggccggaggcgctgcgctggctggcc
aatcaaagctgcatcaccctgcacatgtggcagtcgcgccgggcccggctggaccacccg
gaccgactcgtcttcgatctcgacccgtccgacggcgacttcgccgtggtgcgagcgacc
gcacgcgccaccgccggggtgctcggggacctgggcctggcgtgctacgtccagaccacc
ggctcgcgggggctgcacgtggtcgcccccttgcgcgccgacaccgatttcgacaccgcc
cggcagttcgcccgtgacgtcagcgaagtggtcgccgcggacgatcccgcgcatcgcacc
gtcgaggctcgcaaggacaagcgcgacgggcgggtatacctcgacatcatgcgaaacgcc
tacgcgcagacggcggttgcgccgtattcggttcgggcccgcaacggcgcaccggtagcc
acaccgctggaatgggacgagctggacgccgggcggttgcgggccgaccggttcaccatc
cgcgacgtacccaaacggcttgccggacaaccggatccgtgggcgcacatgtcgcggcac
gcccgctcactggccggcccgctgcgccgattggcgaggctacgtgcctga

DBGET integrated database retrieval system