KEGG   Mycobacterium intracellulare 1956: LG41_15595Help
Entry
LG41_15595        CDS       T03407                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mie  Mycobacterium intracellulare 1956
Pathway
mie00250  Alanine, aspartate and glutamate metabolism
mie00280  Valine, leucine and isoleucine degradation
mie00410  beta-Alanine metabolism
mie00640  Propanoate metabolism
mie00650  Butanoate metabolism
mie01100  Metabolic pathways
mie01120  Microbial metabolism in diverse environments
Module
mie_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mie00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LG41_15595
   00650 Butanoate metabolism
    LG41_15595
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LG41_15595
   00280 Valine, leucine and isoleucine degradation
    LG41_15595
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LG41_15595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mie01007]
    LG41_15595
Enzymes [BR:mie01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LG41_15595
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     LG41_15595
Amino acid related enzymes [BR:mie01007]
 Aminotransferase (transaminase)
  Class III
   LG41_15595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIT86278
UniProt: X8CG22
LinkDB All DBs
Position
3389834..3391174
Genome map
AA seq 446 aa AA seqDB search
MAGLEQTRQLVTEIPGPLSLELSKRRAAAVSHAVNVSVPVFVARAGGGIIEDVDGNRLID
LGSGIAVTTIGNSAPRVVDAVRAQVAEFTHTCFMVTPYESYVAVAETLNRITPGSGEKRS
VLFNSGAEAVENAVKVARAYTRKSAVVAFNHAYHGRTNLTMALTAKSMPYKAGFGPFAPE
VYRAPLSYPYRDGLIDKELATDGEKAAARAIRVIDSQIGADNLAALLIEPIQGEGGFIVP
AEGFLPTLLEWCRRNDVVFIADEVQTGFARSGAMFACEHEGIEPDLICTAKAIADGLPLS
AVTGRANIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLVERAQQLERLITEPLLR
LQAGDDRIGDVRGRGAMIAIELVKSGTAEPDRELTQKLTVAAQAAGVIVLTCGMFGNIIR
LLPPLTIGDELLAEGIDILTGLLRDL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtggccggcctcgagcagactcgccaactggtcaccgagatccccggcccgctctcgctg
gaactgagcaagcgccgggcggcggcggtgtcgcacgcggtcaacgtctccgtcccggtc
ttcgtggcgcgcgccggcggcggcatcatcgaggacgtcgacggcaaccggctcatcgac
ctcggctccggcatcgcggtgacgaccatcggcaactcggcgccccgggtggtcgacgcc
gtgcgcgcgcaggtcgccgagttcacccacacctgcttcatggtgacgccgtacgagtcg
tacgtcgcggtggccgagacgctcaaccggatcaccccgggctccggcgagaagcgctcg
gtgctgttcaattccggcgccgaggccgtcgagaacgccgtcaaggtcgcgcgcgcctac
acgcgcaagtcggcggtggtcgcgttcaaccacgcctaccacggccgcaccaacctgacg
atggcgctgaccgcgaagtccatgccctacaaggccggcttcggcccgttcgcgccggag
gtctaccgggcgccgctgtcctacccctatcgggacggcctgatcgacaaggagctggcc
accgacggggagaaggccgccgcgcgggccatccgggtcatcgacagccagatcggcgcc
gacaacctggccgccctcctgatcgagccgatccagggcgaaggcggattcatcgtgcca
gccgagggattcctgcccaccctgctggagtggtgccgcaggaacgacgtggtgttcatc
gccgacgaggtgcagaccggtttcgcgcgctcgggcgccatgttcgcctgcgaacacgag
ggcatcgagcccgacctgatctgcaccgccaaggcgatcgccgacgggcttcccctgtcg
gcggtcaccggccgggccaacatcatggacgcgccgcacgtcggcggcctcggcggcacc
ttcggcggcaaccccctggcctgcgcggcggcgttggccacgatcgagacgatcgagagc
gacgggctggtcgagcgggcccagcagctggagcggctcatcaccgaaccgctgctgcgg
ctgcaggccggcgacgaccggatcggcgacgtccgcggccgcggcgcgatgatcgcgatc
gagttggtgaagtcggggaccgccgagcccgacagggagctgacccaaaagctgaccgtc
gccgcccaggcggccggcgtcatcgtcctgacctgcggcatgttcggcaacatcatccgg
ctgctgccgccgctgaccatcggcgacgagctgctggccgaaggaatcgacatcctgact
gggttgttgcgcgacctgtaa

DBGET integrated database retrieval system