KEGG   Mycobacterium intracellulare 1956: LG41_20145Help
Entry
LG41_20145        CDS       T03407                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mie  Mycobacterium intracellulare 1956
Pathway
mie00410  beta-Alanine metabolism
mie00430  Taurine and hypotaurine metabolism
mie00650  Butanoate metabolism
mie01100  Metabolic pathways
mie01110  Biosynthesis of secondary metabolites
mie01120  Microbial metabolism in diverse environments
mie02024  Quorum sensing
Module
mie_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mie00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LG41_20145
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LG41_20145
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LG41_20145
   00430 Taurine and hypotaurine metabolism
    LG41_20145
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LG41_20145
Enzymes [BR:mie01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LG41_20145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIT87152
LinkDB All DBs
Position
complement(4283927..4285309)
Genome map
AA seq 460 aa AA seqDB search
MPQHPSLPAHSIAPAYTGRLFTAPVPALRMPDESMDPDAAYRFIHDELMLDGSSRLNLAT
FVTTWMDPEAGKLMAETFDKNMIDKDEYPATAAIEQRCVCMVADLFHADGLNDADPYSAC
GVSTIGSSEAVMLGGLAMKWRGGAKIGKDWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRY
LPMEEGRYVITPEQVVDAVDENTIGVVAILGTTYTGELEPVADICGALDKLAAGGGVDVP
VHVDAASGGFVVPFLHPELKWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRSKEYLPDDL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQALSGTARWLGEQLRV
SEHCELVSDGSAIPVVAFRLAKDRGYTEFDVSHELRTYGWQVPAYTMPDNATNVSVLRIV
VREGLSADLARALHDDAVSALSSLDKLRPGGHYADQHFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgccacaacacccttcgctgcccgcgcactccatcgcccccgcctacacgggccggctg
ttcaccgcgccggtccccgcactgcggatgcccgacgaatcgatggatcccgacgccgcc
taccggttcatccacgacgagctgatgctcgacgggagttcgcggctgaacctggccacc
ttcgtcaccacctggatggaccccgaggccggcaagctgatggccgagacgttcgacaag
aacatgatcgacaaggacgagtacccggcgaccgcggccatcgagcagcgctgcgtgtgc
atggtggccgacctgttccacgccgacggcctgaacgacgccgacccctacagcgcgtgc
ggggtgtccacgatcggctccagcgaggcggtgatgctcggcgggctggcgatgaagtgg
cgggggggcgcgaaaatcggcaaggactggaagggccgcaccccgaacctggtgatgggg
tccaacgtccaggtggtctgggagaagttctgccgctacttcgacgtcgagccccgctac
ctgccgatggaggaggggcgctatgtcatcacccccgaacaggtcgtcgacgccgtcgac
gagaacaccatcggcgtggtggcgatcctgggcaccacctacaccggcgagctggagccg
gtcgccgacatctgcggcgcgctggacaagctggccgccggcggcggtgtggacgtcccg
gtgcacgtcgacgccgccagcggcggattcgtggtgcccttcctgcaccccgagctcaag
tgggacttccggctgccccgggtggtgtcgatcaacgtcagcggccacaagtacgggctg
acctatcccggcgtcgggttcgtggtgtggcgcagcaaggagtacctgcccgacgacctg
gtgttccgggtcaactatctcggcggcgatatgccgaccttcacgctgaacttctcccgg
cccggcaaccaggtggtcggccagtactacaacttcctgcggctcggccgggagggctac
accaaggtcatgcaggcgctgtccgggacggcgcgctggctcggtgagcagctgcgggtc
agcgagcactgcgagctggtctccgacggctcggcgatccccgtggtcgcgttccggctg
gccaaggaccgcggctacaccgagttcgacgtctcccacgagcttcggacctacggctgg
caggtgcccgcctacaccatgccggacaacgccaccaacgtctccgtgctgcgcatcgtg
gtgcgcgagggcctgtccgccgacctggcccgggccctgcacgatgacgccgtctcggcg
ctcagttcgctggacaagctccggcccggcggccactacgcggatcagcacttcgcgcac
tga

DBGET integrated database retrieval system