KEGG   Methanocaldococcus infernus: Metin_0801Help
Entry
Metin_0801        CDS       T01234                                 

Definition
(GenBank) DNA ligase I, ATP-dependent Dnl1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mif  Methanocaldococcus infernus
Pathway
mif03030  DNA replication
mif03410  Base excision repair
mif03420  Nucleotide excision repair
mif03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mif00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Metin_0801
   03410 Base excision repair
    Metin_0801
   03420 Nucleotide excision repair
    Metin_0801
   03430 Mismatch repair
    Metin_0801
Enzymes [BR:mif01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Metin_0801
    6.5.1.6  DNA ligase (ATP or NAD+)
     Metin_0801
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Metin_0801
DNA replication proteins [BR:mif03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Metin_0801
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Metin_0801
DNA repair and recombination proteins [BR:mif03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Metin_0801
   NER (nucleotide excision repair)
    Other NER factors
     Metin_0801
   MMR (mismatch exicision repair)
    Other MMR factors
     Metin_0801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2 ALIX_LYPXL_bnd
Motif
Other DBs
NCBI-ProteinID: ADG13466
UniProt: D5VSB3
LinkDB All DBs
Position
complement(719991..721688)
Genome map
AA seq 565 aa AA seqDB search
MLWKEVCEIFNKIENTTKRLDKRAYFIKLLEKVKDPEDLKRICYIAIGRVFPEYDERELG
VGEKLLINAIISSGINKDKLYEKIKETGDIGLAAEKAKEEGKVKTLLFSPLTVKEVFETL
RKVAETEGEGSQKKKMRLISSLFLRASPIERRYLARLILGDMRIGMNIPTVLEALSIYFN
VPKEKLEKIYAVTNDIGLLAEKLMKNELDDKELNIKLFRPIKPMLAQLAPSIEEAIIEMG
HPQFETKYDGARIQIHKKGDKVKIYSRKLEDVTHALPEIVNEIKKFKHDLIVEGECVAIE
EGRPRPFQDILRRFRRKHDIGKAMKKINLRAYLFDLLYKDGESYIDKPFKERRKALEELV
GYENDWRKERERIERELKEDKKIDISYKLVTNDPREAKEFYKWSLSIGHEGVMIKNLNAP
YTPGSRVRTMYKFKPTLENLDVVITKAKRGMGKRKDWYGSFEICVKDKDGNLQPIGYVGT
GLTEEDLQMLKEMIDKIVVKDLGDEVIVKPEIVVEVAYEEIQKSDKYPCGYALRFPRIVR
FRFDKSIEDINTLEDVERIYKLQRK
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgttgtggaaagaagtttgtgaaatttttaacaagatagagaatacaactaagaggtta
gataagagagcttactttataaaattgcttgagaaggttaaagatcctgaggatttaaaa
agaatttgctatatagccataggaagagttttcccagagtatgatgagagagagcttggt
gttggggagaagttattgattaatgctatcatctcctcaggaattaataaggataagctc
tatgagaagattaaagagactggagatattggcttagctgctgagaaggctaaggaagaa
gggaaggttaaaactcttctcttctctccactgacagttaaggaggtttttgagacatta
aggaaggttgctgagactgaaggagagggtagccagaaaaagaagatgaggcttatatca
agcctatttttaagagcaagcccaatagagaggagatacttagcaaggcttattttagga
gacatgaggataggaatgaacattcccacagttttagaagctctttccatttatttcaat
gtccctaaagagaagttagaaaaaatttatgctgtaactaatgacattggtttattggct
gagaagttaatgaagaatgagcttgatgataaagaacttaacattaagttatttagacca
ataaaacctatgcttgctcagctggctccttcaatagaggaagctattatagagatggga
catcctcagtttgaaaccaagtatgatggagcaaggatccagatacataagaagggagat
aaggttaaaatttacagtagaaagttggaagatgttacccatgccttgccagagattgtt
aatgagataaagaagtttaaacatgacttaattgttgaaggtgagtgtgtagccatagag
gaaggaagaccaaggccttttcaagacatactaaggagatttagaaggaaacatgatatt
ggaaaggctatgaaaaagattaacttaagggcttatctatttgacttactatataaggat
ggagaatcttacatagataaaccttttaaagagagaaggaaagctttagaagagcttgta
ggatatgagaatgattggaggaaagagagggagaggatagagagggaattaaaggaggat
aagaagatagatatctcttataagttggtaactaatgacccaagagaggctaaagagttt
tataagtggtctctatctataggacatgagggagttatgatcaaaaatttaaatgctcct
tacactccagggagtagagtaagaactatgtataaatttaaacctaccttagaaaactta
gatgttgtcataacaaaggctaagagaggaatgggaaagagaaaggattggtatggctct
tttgagatttgtgttaaagataaagatgggaatttacagcctataggttatgtgggaact
ggcttaactgaagaggatttacagatgcttaaggagatgattgataagatagttgttaaa
gaccttggagatgaggttatagttaagccagagattgttgttgaagtggcttatgaagag
attcagaaatctgataaatacccctgtggctatgctctcagatttccaagaattgttagg
tttaggtttgataagagtatagaggatataaatacacttgaagatgttgagagaatttac
aagcttcagagaaagtaa

DBGET integrated database retrieval system