KEGG   Methanocaldococcus infernus: Metin_1339Help
Entry
Metin_1339        CDS       T01234                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mif  Methanocaldococcus infernus
Pathway
mif00010  Glycolysis / Gluconeogenesis
mif00020  Citrate cycle (TCA cycle)
mif00620  Pyruvate metabolism
mif00633  Nitrotoluene degradation
mif00640  Propanoate metabolism
mif00650  Butanoate metabolism
mif00680  Methane metabolism
mif00720  Carbon fixation pathways in prokaryotes
mif01100  Metabolic pathways
mif01110  Biosynthesis of secondary metabolites
mif01120  Microbial metabolism in diverse environments
mif01130  Biosynthesis of antibiotics
mif01200  Carbon metabolism
Module
mif_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mif_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metin_1339
   00020 Citrate cycle (TCA cycle)
    Metin_1339
   00620 Pyruvate metabolism
    Metin_1339
   00640 Propanoate metabolism
    Metin_1339
   00650 Butanoate metabolism
    Metin_1339
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metin_1339
   00680 Methane metabolism
    Metin_1339
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metin_1339
Enzymes [BR:mif01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metin_1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II OxoGdeHyase_C DUF2524
Motif
Other DBs
NCBI-ProteinID: ADG13989
UniProt: D5VTT6
LinkDB All DBs
Position
1201322..1202455
Genome map
AA seq 377 aa AA seqDB search
MKKVITGTSAAAEAVRLCDVDVVAAYPITPQTSCVEKIAEFVANGELDAEYIKVESEHSA
MAACIGASATGARTFTATASQGLALMHELLFIASGMRLPIVMLNTNRALSAPINIWCDHQ
DSISQRDTGWIQLYAENNQETLDLVIQAYKIAETVLLPVMVNIDGFILTHTVEPVEIPEE
EKVRNFVGVYEPRHAYLDPDRPITQGPVGVPECYMETRKQIEEAMEEAKKVIDKVNKEFE
KEFGRKYSLIETYNLENADTVLMAMGSVCGTIKHYINNYDNKVGLIKVRTYRPFPKEEIR
KVLEDFDKVGILDKNISFGMNMGALAIDCLTILKDKTICNYIVGLGGRDITIQNIKEIVE
NLRRAKKDKTEWIGLNK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggttataactggaacttcagcagctgctgaagctgttaggttgtgtgacgtt
gacgttgttgcagcttatccaatcactccacaaacaagctgtgttgaaaagatagctgaa
tttgtggctaatggagagttggatgctgaatatataaaggttgagagtgagcactcagca
atggctgcctgtataggagcaagtgctacaggagcaagaacctttactgctacagcttct
caaggattagctttaatgcatgaacttctcttcatagcttcagggatgagattaccaata
gttatgctaaacacaaatagagcattatcagctccaataaatatatggtgtgatcatcaa
gattctatatcccaaagagacactggttggatacaactttatgctgagaacaaccaggaa
actttagatttggttatacaagcttataagatagctgaaactgtcttacttccagtgatg
gttaatattgatgggtttatcttaacccatacagttgagcctgttgagattccagaggaa
gagaaggttagaaactttgttggagtttatgagccaaggcatgcatacttagatccagat
aggccaataacccaaggacctgtaggagtgccagagtgttacatggaaacaagaaaacag
atagaggaagctatggaagaggctaagaaagttattgataaggttaataaagagtttgaa
aaagagtttggcagaaagtatagtttaattgaaacttataacttggagaatgctgacact
gtcttaatggctatgggatcagtttgtggaaccattaaacactacatcaataactatgac
aataaggttggtctcataaaggttagaacatatagacccttcccaaaagaggagataagg
aaagttttagaagattttgataaggttggaatcttagataaaaatataagctttggaatg
aacatgggagctttagctatagattgcttaactatacttaaggataaaactatctgtaat
tatatagttgggcttggaggaagggatataacaattcagaatattaaggagattgttgaa
aacttaagaagagctaaaaaagataaaactgagtggataggactaaataaataa

DBGET integrated database retrieval system