KEGG   Methanotorris igneus: Metig_0531Help
Entry
Metig_0531        CDS       T01510                                 

Definition
(GenBank) hypothetical protein
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mig  Methanotorris igneus
Brite
KEGG Orthology (KO) [BR:mig00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Metig_0531
Enzymes [BR:mig01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Metig_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AEF96086
UniProt: F6BC05
LinkDB All DBs
Position
complement(528530..529690)
Genome map
AA seq 386 aa AA seqDB search
MEIDYALIAERLKLREEDIRRGFKRGIIIREEYKGVPMIAFRKKIKHIERGTALFLNENL
DYIMGYPKIRRALVLNPTIKNYFIDKVVVEEKLDGYNVRIAKINNNIVAITRGGHVCPFT
TKKAIQILNTKFFDNNPNLMLCGEMIGLNNPYVPHYYEEVDRGWENLGFYIFDIRDRETN
EPLSIKEKIEICKKYNLPYVEPIGEFDKEDAHEYIKEIIDRLNAENREGVVLKDPDMAIN
PIKYTTHKTQCGDLKAAFTFFYDLGVDFMFSRVVREGYQAFEFNENDDALKKRALDIGES
ILYPMVDTIKKVHSGERVTEDFEIVVDSEEDLKEFLEYLKRLHMQFIIKNMEKIKADDEY
KIKVKIGKIYSATNDKVLSHLNGGLW
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagattacgctttaattgcggaaagattgaagttgagagaagaggatataaga
aggggattcaaaagagggataatcattagagaagaatataaaggagttccaatgattgca
tttagaaaaaagataaaacatattgagagaggaacggctttatttttaaatgaaaatttg
gattatattatgggatacccaaaaattagaagggcgttagtgttaaatccaacgataaag
aattacttcattgataaggtcgttgttgaggaaaagttggatggttataatgttagaata
gcaaaaataaataataatattgttgcaattacaagaggaggacatgtttgcccattcaca
acaaaaaaagcaatacaaatattaaacactaaattctttgataacaatccaaacctaatg
ctgtgcggggagatgattggattaaacaatccctatgtgccacactattatgaagaagtc
gataggggctgggaaaacttaggattttacatttttgatataagagatagagaaacaaat
gaacctttatccataaaagagaaaatagaaatctgcaaaaaatacaaccttccttatgtt
gagccgattggggaatttgacaaggaagatgctcatgaatacataaaggagattattgat
agattaaacgctgagaatagggaaggagttgttttaaaagacccagatatggcaataaat
ccaataaaatacacaacacataaaacacagtgcggggatttaaaggcggcatttacgttc
ttctatgatttgggagttgactttatgtttagtagagttgtcagggagggatatcaagca
tttgaattcaatgaaaatgatgatgcattaaaaaagagggcattggatattggagaatct
atcctatacccaatggtagacacaataaaaaaggttcatagtggtgagagagttacagag
gactttgaaattgtcgtagatagcgaggaggatttgaaagagtttttagaatacttaaag
agattacatatgcaatttatcatcaaaaacatggaaaaaataaaggcagatgatgaatat
aaaataaaggtgaaaattgggaagatatattctgcaactaacgacaaagttctgagtcat
ttaaatggtggtctatggtga

DBGET integrated database retrieval system