KEGG   Methanotorris igneus: Metig_1239Help
Entry
Metig_1239        CDS       T01510                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit D
  KO
K00580  tetrahydromethanopterin S-methyltransferase subunit D [EC:2.1.1.86]
Organism
mig  Methanotorris igneus
Pathway
mig00680  Methane metabolism
mig01100  Metabolic pathways
mig01120  Microbial metabolism in diverse environments
mig01200  Carbon metabolism
Module
mig_M00567  Methanogenesis, CO2 => methane
mig_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mig00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Metig_1239
Enzymes [BR:mig01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Metig_1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrD
Motif
Other DBs
NCBI-ProteinID: AEF96776
UniProt: F6BE99
LinkDB All DBs
Position
1241550..1242275
Genome map
AA seq 241 aa AA seqDB search
MECGDIMDAVSLLIPLAEITIAGAIINASVHFVPVGGAPAAMATSTGVGTGTTQLAAGAG
FTGLMAAAAMAAQAGVDVFNPAHLALIALSGAVGSMIMLGITMLIGQLIYVFGVGVVPAA
DKCEKDPITGDEQRPYITPGTTGHAVPTVCFVSGLIGAGLGGIGGALAYIALKQLGFDTA
IAGILAVGFFFINAVLASYNIGGTIEGFHDPKFKKMPNGVIASFVASLLCGLVLLGMAGL
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtggtgatatcatggatgctgtgagtttattgatacctcttgcagaaattaca
attgcaggggctataattaatgcaagtgttcattttgttcctgtcggtggagctccagca
gcaatggctacatcaactggggtaggtacaggtacaacacagttagcggcaggtgcaggg
tttactggattaatggctgctgcagcaatggctgctcaggcaggagttgacgtattcaat
ccagcacacttggctttaattgctctttctggagcagtaggttcaatgattatgcttggt
attacaatgttgattgggcagttgatttatgtatttggagtaggggttgttccagcagca
gataagtgtgaaaaagaccctataacaggagatgaacaaagaccttacatcacaccaggt
acaactggtcacgcagttcctacagtttgttttgttagtggtttaattggagcaggactt
ggaggtattggtggggctcttgcgtacattgcattaaaacaattaggatttgacacagca
attgctggaattttagcagttgggtttttcttcataaatgcggttcttgcgtcctataac
attggaggaacaatcgaaggattccacgatccaaaattcaagaaaatgccaaatggggtt
atagcatcattcgtagcatcattattgtgtggacttgtattattaggaatggcaggtttg
gcataa

DBGET integrated database retrieval system