KEGG   Methanotorris igneus: Metig_1280Help
Entry
Metig_1280        CDS       T01510                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mig  Methanotorris igneus
Pathway
mig00630  Glyoxylate and dicarboxylate metabolism
mig01100  Metabolic pathways
mig01120  Microbial metabolism in diverse environments
mig01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Metig_1280
Enzymes [BR:mig01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Metig_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AEF96817
UniProt: F6BEM0
LinkDB All DBs
Position
complement(1289756..1291033)
Genome map
AA seq 425 aa AA seqDB search
MDYVDLNYTPSENDLLSCIRVKAKNLMKVANEIAAESSIGTWTKVQTMKSDVYEKLRPKV
YEIEEIGEEGESKVGIIKIAYPLDAFEIENMPGTLAGIAGNIFGMKIVDGLRILDYRFPE
KFVKAYRGPRYGIDGIRKLLKVEERPLLGTIVKPKVGLKTDEFAEVAYNAWIGGCDIVKD
DENLVSQSFNKFEDRIFKVLELRDKAEEETGEKKIYMPNITAPYREMIKRAELAEDAGSE
YVMLDVVVLGFSAVQQFREEDFKFVIHAHRAMHAAITRSKDWGITMLTLAKIYRLLGVDQ
LHIGTVVGKMEGERAEVCAIRDEIVLDKVEKDDKNKFFDQDWFGMNNVFPVASGGVYPKL
VPEIIEILGKDVIIQAGGGIHGHPEGTVKGAIAMRAAIDAVMEGKSLEEKAEEVKELKVA
LEHWK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggactatgttgatttgaactatacgccaagtgagaatgatttgctatcttgcataagg
gtaaaggcaaaaaatttaatgaaagttgcaaatgaaattgcggcagaaagttctatagga
acatggacaaaagttcaaacaatgaaaagtgatgtatatgaaaaattaagaccaaaggtt
tatgaaattgaagagattggggaagagggggagagtaaagtaggaataataaaaattgcc
tatccgctggatgcctttgaaattgaaaacatgccgggaacattggcagggattgctggg
aacatatttggaatgaaaattgttgatggattgagaattttagattacagattcccagaa
aagttcgttaaggcatacagagggccaagatatggaattgatggtataagaaaattgcta
aaagttgaggaaaggccattactcggaaccatagtaaaaccaaaagttgggttaaaaaca
gatgaatttgcagaagttgcatacaacgcatggattgggggatgtgacatagttaaggat
gatgagaaccttgtgtcccaaagtttcaacaaatttgaggatagaatctttaaggtttta
gagttgagagataaggcagaggaagaaactggagagaaaaaaatctacatgccaaatatc
actgctccatacagagaaatgattaagagagctgaacttgcagaggatgcaggaagcgag
tatgttatgcttgatgttgtagttctcggattctctgcagtgcaacagtttagagaagag
gatttcaaattcgtaattcatgcccacagagcaatgcacgctgcgataacccgttcaaag
gattggggaataactatgctaactctcgctaagatatacaggcttttaggagttgatcaa
ctccacattggaaccgttgttggtaaaatggaaggagaaagggctgaggtttgtgctata
agggatgagattgtattggataaagttgagaaagatgataaaaataaattcttcgaccaa
gattggtttggaatgaataatgttttcccagtagcttctgggggagtttatcctaagtta
gttccagaaatcattgaaattcttggaaaagatgttattatccaggcaggtggtggaatt
cacgggcatccagaaggaactgttaaaggagcaatagctatgagggcagcgatagatgca
gttatggaaggaaaatcattagaagagaaggcagaagaggttaaagaattaaaagtggca
ttggagcattggaaataa

DBGET integrated database retrieval system