KEGG   Methanotorris igneus: Metig_1355Help
Entry
Metig_1355        CDS       T01510                                 

Definition
(GenBank) Pyruvate synthase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mig  Methanotorris igneus
Pathway
mig00010  Glycolysis / Gluconeogenesis
mig00020  Citrate cycle (TCA cycle)
mig00620  Pyruvate metabolism
mig00633  Nitrotoluene degradation
mig00640  Propanoate metabolism
mig00650  Butanoate metabolism
mig00680  Methane metabolism
mig00720  Carbon fixation pathways in prokaryotes
mig01100  Metabolic pathways
mig01110  Biosynthesis of secondary metabolites
mig01120  Microbial metabolism in diverse environments
mig01130  Biosynthesis of antibiotics
mig01200  Carbon metabolism
Module
mig_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mig_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metig_1355
   00020 Citrate cycle (TCA cycle)
    Metig_1355
   00620 Pyruvate metabolism
    Metig_1355
   00640 Propanoate metabolism
    Metig_1355
   00650 Butanoate metabolism
    Metig_1355
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metig_1355
   00680 Methane metabolism
    Metig_1355
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metig_1355
Enzymes [BR:mig01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metig_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C OxoGdeHyase_C IL10 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: AEF96890
UniProt: F6BF20
LinkDB All DBs
Position
1371383..1372543
Genome map
AA seq 386 aa AA seqDB search
MCKVKVITGTSAAAEAAKLADVDVIAAYPITPQTTCVEKLAEFVANGELDAEFIKVESEH
SAMSACIGASATGARTFTATASQGLALMHEMLFIAAGMRLPIVMMNANRALSAPINIWND
QQDSISQRDTGWIQFYVEDNQETLDTILQAYRIGEHEDVLLPVMVNLDGFILTHTVEPVT
IPSEENAKAFVGVYEPKHAYLDPDRPITQGCVGVPECYMETRYAVEKAMENAKKVIKEIH
DEFAEKFKRSYGNGLIEEYNMENADTVIVAMGSVCGTIKEVIDRLKEKGKEVGLLRVRCY
RPFPAEDIAKALKDAENIAVLDKNISLGINKGALYLDLASTVRDKKVVNYIVGLGGRDIR
IEDIEKIISHVEVAKDGETAWIGLKE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaggtcaaagttataactggaacaagtgcagcggcagaggctgcaaaattggcg
gatgttgatgttattgcagcgtatccaataaccccacaaacaacatgtgttgagaaactt
gctgagtttgttgctaatggggagttagatgcagaatttatcaaagtagagagtgagcat
tcagcaatgagtgcttgtataggggcaagtgcaacaggagcaaggacatttacagcaact
gcatcccaaggacttgctttgatgcatgagatgttgtttattgctgcagggatgaggtta
ccaattgtcatgatgaacgcaaacagggcattatctgccccaataaacatctggaacgac
caacaagatagtatatcccaaagagacactggatggatacaattttatgttgaggacaac
caagaaacactcgatacaatattacaagcatacagaataggggagcatgaagatgtttta
ttgccagtaatggttaaccttgatggattcatcttgactcacacagtagaaccagtaaca
attccttcagaagagaatgctaaagcattcgttggagtttatgaaccaaaacatgcttac
ttagacccagataggccaataacacaaggatgtgtcggagttccagagtgctacatggaa
acaagatacgcagttgaaaaggcaatggaaaatgcaaagaaagttattaaagagattcac
gatgagtttgcagaaaagttcaagagaagctatggaaatggtttaattgaagaatacaac
atggaaaatgctgatactgttatcgttgcaatgggaagtgtctgtggaacaattaaggaa
gttattgataggttaaaagagaaaggaaaagaagttggtttgttgagagtcagatgctac
agaccattcccagcagaagatattgcaaaagcattaaaagatgcagaaaacattgcagtt
ctcgacaaaaacataagtttaggtataaataaaggagcattatacttagatttagcttca
acagttagagacaaaaaagttgttaattacattgttggtttgggaggaagagacataaga
atagaggacattgaaaaaatcatctcacacgttgaagttgcaaaggatggagaaactgca
tggattggattaaaggaataa

DBGET integrated database retrieval system