KEGG   Microbacterium sp. BH-3-3-3: BJP65_04950Help
Entry
BJP65_04950       CDS       T04827                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mih  Microbacterium sp. BH-3-3-3
Pathway
mih00020  Citrate cycle (TCA cycle)
mih00190  Oxidative phosphorylation
mih00650  Butanoate metabolism
mih01100  Metabolic pathways
mih01110  Biosynthesis of secondary metabolites
mih01120  Microbial metabolism in diverse environments
mih01130  Biosynthesis of antibiotics
mih01200  Carbon metabolism
Module
mih_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mih_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mih_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJP65_04950
   00650 Butanoate metabolism
    BJP65_04950
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BJP65_04950
Enzymes [BR:mih01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BJP65_04950
    1.3.5.4  fumarate reductase (quinol)
     BJP65_04950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 HI0933_like DAO FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AOX45227
LinkDB All DBs
Position
1067129..1068958
Genome map
AA seq 609 aa AA seqDB search
MSTQTTADSTVKDGVHYHQFDVIIVGAGGAGMRAAIEAGPGAKTAVISKLYPTRSHTGAA
QGGMAAALANVEEDSWEWHTFDTIKGGDYLVDQDAAEILAKEAIDAVIDLENMGLPFNRT
PEGKIDQRRFGGHTADHGKTPVRRACYAADRTGHMILQTLFQNCVKLGINFFNEFYVLDL
ITVKDAAGATQVAGVVAYDLATGELHVFQSKAVVFATGGFGKIFKTTSNAHTLTGDGVGI
VWRKGLPLEDMEFFQFHPTGLAGLGILLTEGARGEGAILRNASGERFMERYAPTIKDLAP
RDIVARCMVQEVSEGRGAGPHRDYVLLDCTHLGAEVLETKLPDITEFARTYLGVDPVVEP
VPVMPTAHYAMGGIPTNIKAEVLADNDTVVPGLYAAGECACVSVHGSNRLGTNSLLDINV
FGKRAGRNAVEYVKTADFVPLPEDPAAEVRGLIEGLRNNSGTERIAVLRKTLQDEMDKGA
QVFRTHDSLSKVLDVIADLRERYKNIHVDDKGKRFNTDLLEAVELGFLLDLAEVVVYSAQ
NREESRGGHMRDDFPTRDDEKYMQHTMAYLSGDPHSSHPADHIELGWKPVVFTKNEAGEL
RYPPLERKY
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactcagaccaccgcggactccaccgtcaaagacggtgtccactaccaccagttc
gacgtcatcatcgtcggcgccggcggcgcaggcatgcgcgcggcgatcgaggccggcccc
ggtgcgaagaccgcggtcatctcgaagctctaccccacccgctcccacacgggcgcagcg
cagggcggcatggccgcagcgctggcgaacgtcgaagaggactcctgggagtggcacacc
ttcgacaccatcaagggcggcgactacctggtcgaccaggatgccgcggagatcctcgcc
aaagaggccatcgacgccgtcatcgacctcgagaacatgggcctgccgttcaaccgcacg
cccgagggcaagatcgaccagcggcgctttggcggtcacaccgccgaccacggcaagacg
cccgtgcgccgcgcctgctacgccgccgaccgcaccggccacatgatccttcagacgctg
ttccagaactgcgtcaagctcggcatcaacttcttcaacgagttctacgtgctcgacctg
atcacggtcaaggacgcggcgggcgcgacccaggtcgccggcgtcgtcgcgtacgacctg
gccaccggcgagctgcacgtcttccagtccaaggccgtcgtcttcgccaccggcggtttc
ggcaagatcttcaagaccacgtccaacgcgcacaccctcaccggtgacggcgtcggcatc
gtgtggcgcaagggcctgccgctcgaggacatggagttcttccagttccacccgaccggc
ctcgccggtctcggcatcctgctcaccgagggcgcccgtggcgagggagcgatcctgcgc
aacgccagcggtgagcgcttcatggagcgctacgccccgaccatcaaggacctcgcgccc
cgtgacatcgtcgcgcgctgcatggtgcaggaggtctcggagggccgcggcgccggtccc
caccgcgactacgtgctgctggactgcacccacctgggtgccgaggtgctcgagaccaag
ctccccgacatcaccgagttcgcccgcacgtacctgggcgtcgacccggtcgtcgagccg
gtccccgtcatgccgaccgcgcactacgcgatgggcggcatcccgaccaacatcaaggcc
gaggtgctcgccgacaacgacaccgtcgtgcccggcctctacgccgccggcgagtgcgcc
tgcgtctcggtgcacggctcgaaccgcctcggcaccaactcgctgctcgacatcaacgtg
ttcggcaagcgcgccggacgcaacgcggtcgagtacgtcaaaacggccgacttcgtgccc
ctgcccgaagaccccgccgccgaggtgcgcggactcatcgaggggctccgcaacaacagc
gggaccgagcgcatcgccgtcctgcgcaagacgctgcaggacgagatggataagggcgcg
caggtgttccgcacccacgactcgctctcgaaggtgctcgacgtgatcgccgacctgcgc
gagcgctacaagaacatccacgtcgacgacaagggcaagcgcttcaacaccgacctgctc
gaagcggttgagctgggcttcctgctcgacctcgccgaggtcgtcgtctactcggcgcag
aaccgcgaagagagccgtggcggtcacatgcgcgacgacttccccacgcgcgacgacgag
aagtacatgcagcacaccatggcgtacctgtcgggcgacccccactcgtcgcacccggcc
gatcacatcgagctgggctggaagcccgtggtgttcaccaagaacgaggcgggcgagttg
cgttacccgccgcttgagaggaagtactga

DBGET integrated database retrieval system