KEGG   Microbacterium sp. BH-3-3-3: BJP65_04955Help
Entry
BJP65_04955       CDS       T04827                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mih  Microbacterium sp. BH-3-3-3
Pathway
mih00020  Citrate cycle (TCA cycle)
mih00190  Oxidative phosphorylation
mih00650  Butanoate metabolism
mih01100  Metabolic pathways
mih01110  Biosynthesis of secondary metabolites
mih01120  Microbial metabolism in diverse environments
mih01130  Biosynthesis of antibiotics
mih01200  Carbon metabolism
Module
mih_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mih_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mih_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJP65_04955
   00650 Butanoate metabolism
    BJP65_04955
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BJP65_04955
Enzymes [BR:mih01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BJP65_04955
    1.3.5.4  fumarate reductase (quinol)
     BJP65_04955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4 Fer4_20 Fer4_4 Fer4_6 Fer4_2 Fer4_15 Fer4_18 Fer4_16 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AOX45228
LinkDB All DBs
Position
1068960..1069745
Genome map
AA seq 261 aa AA seqDB search
MASTVIESVDTSDKVEQTPEDTGIQSFLVTFNIRRFDPEVDDEPRWVDYDVELYSTDRVL
DALHKIKWETDGSLSFRRSCAHGICGSDAMRINGRNRLACKTLIKDLDISQPIYVEAIKG
LPLEKDLIVDMEPFFASYREVQPFLISSSKPEAGKERVQSIVDREVFDDTTKCILCAACT
SSCPVFWTDGQYFGPAAIVNAHRFIFDSRDDAGDVRLDILNDKEGVWRCRTTFNCTEACP
RGIEVTKAIAEVKQAVLRGGR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaccgtcatcgagagcgtcgacacctccgacaaggtcgagcagaccccggag
gacaccgggatccagtcgttcctcgtcaccttcaacatccgtcgcttcgaccccgaggtc
gacgacgagccgcgttgggtcgactacgacgtggagctctactccaccgaccgcgtgctc
gacgcgctgcacaagatcaagtgggagaccgacggctcgctgtcgttccgccgctcctgc
gcgcacggcatctgcggatcggatgccatgcgcatcaacggccgcaaccgcctggcctgc
aagacgctgatcaaggatcttgacatctcgcagcccatctacgtcgaggcgatcaagggc
ctgcccctcgagaaggacctcatcgtcgacatggagccgttcttcgcctcctaccgcgag
gtgcagcccttcctgatctcgagctcgaagcccgaggccggcaaagagcgcgtgcagtcg
atcgtcgaccgcgaggtcttcgacgacaccaccaagtgcatcctgtgcgccgcgtgcacc
tcgtcgtgccccgtgttctggaccgacgggcagtacttcggccccgccgcgatcgtcaac
gcgcaccgcttcatcttcgactcgcgcgacgacgccggcgacgtgcgtctcgacatcctg
aacgacaaagagggcgtgtggcgttgccgcaccaccttcaactgcaccgaggcgtgcccc
cgcggcatcgaggtcaccaaggccatcgccgaggtcaagcaggccgtcctccgcggcggt
cgctga

DBGET integrated database retrieval system