KEGG   Microbacterium sp. BH-3-3-3: BJP65_10370Help
Entry
BJP65_10370       CDS       T04827                                 

Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mih  Microbacterium sp. BH-3-3-3
Pathway
mih00071  Fatty acid degradation
mih00280  Valine, leucine and isoleucine degradation
mih00281  Geraniol degradation
mih00310  Lysine degradation
mih00360  Phenylalanine metabolism
mih00362  Benzoate degradation
mih00380  Tryptophan metabolism
mih00410  beta-Alanine metabolism
mih00627  Aminobenzoate degradation
mih00640  Propanoate metabolism
mih00650  Butanoate metabolism
mih00903  Limonene and pinene degradation
mih00930  Caprolactam degradation
mih01100  Metabolic pathways
mih01110  Biosynthesis of secondary metabolites
mih01120  Microbial metabolism in diverse environments
mih01130  Biosynthesis of antibiotics
mih01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BJP65_10370
   00650 Butanoate metabolism
    BJP65_10370
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BJP65_10370
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJP65_10370
   00310 Lysine degradation
    BJP65_10370
   00360 Phenylalanine metabolism
    BJP65_10370
   00380 Tryptophan metabolism
    BJP65_10370
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJP65_10370
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BJP65_10370
   00281 Geraniol degradation
    BJP65_10370
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJP65_10370
   00627 Aminobenzoate degradation
    BJP65_10370
   00930 Caprolactam degradation
    BJP65_10370
Enzymes [BR:mih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BJP65_10370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AOX46164
LinkDB All DBs
Position
2240869..2241933
Genome map
AA seq 354 aa AA seqDB search
MHAQRTDDDSVLVRSRRGLGRLTLNRPRAINALDLDMIRALTLTLDRWQRDTDVDVVLLD
GAGERGFCAGGDVRALHEMVVGGRGDEVHAFFREEYALDHLIATSAKPVVAIADGVCMGG
GIGLAGHAAIRVVTDRSRLAMPETRIGFTPDVGGSWLLACAPGRLGEYLGLTGGSMDAAD
AIYAGFADHMVPAAHLEALYEALENRADPSSPTELVLLFDESPEPSRLIAAREWIDDAFA
ADDVPAIVDRLRARPEPEARETAELLAASAPTALAVTLEAVRRARALPSLRAALAQEYGL
VMWFAQTQPDLVEGIRAQVVDKDRSPSWSPARLDDLPADRVAEAFAYEPNPALW
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgctcagcgaaccgatgacgacagcgtcctcgtgcggtcgaggcgcggcctcggt
cgtctgacgctgaatcgtccgcgcgcgatcaacgcgctcgacctcgacatgatccgcgcg
ttgaccctcaccctcgaccggtggcagcgcgacaccgacgtcgacgtcgtgctgctcgac
ggggccggcgagcgcgggttctgcgccggcggcgacgtgcgcgctctgcacgagatggtc
gtcggcggccgcggcgacgaggtgcacgcgttcttccgcgaggagtacgcgctcgaccac
ctcatcgccacctcggccaagcccgtcgtcgcgatcgccgacggcgtgtgcatgggcggc
gggatcggcctcgccggccacgcggccatccgcgtcgtcaccgaccgttcgcggctcgcc
atgcccgagacgcgcatcggcttcacccccgacgtgggcggctcctggctgctggcttgc
gcgcccggtcgcctgggcgagtacctcgggctgaccggggggtcgatggatgccgccgac
gcgatctacgccggcttcgccgaccacatggtgcccgccgcccacctcgaggccctgtac
gaagccctcgagaaccgcgccgacccgtcgagcccgaccgagctcgtgctgttgttcgac
gagagccccgagccgtcgaggctgatcgcggcgagggaatggatcgacgacgcgttcgcg
gccgacgacgttcccgccatcgtggaccgtctgcgtgcgcggcccgagcccgaggcccgc
gagacggccgagctgctggccgcatcggcgccgaccgcgctcgccgtgacgctcgaggcg
gtgcgtcgggcgcgtgccctgccgtcgctgcgcgcggccctcgcccaggaatacggcctc
gtgatgtggttcgcccagacgcagcccgacctggtggagggcatccgcgcgcaggtcgtc
gacaaggaccgctcgccgtcgtggtcgccggcccgcctcgacgatctccccgccgaccgc
gtggccgaggccttcgcgtacgagccgaacccggcgctgtggtga

DBGET integrated database retrieval system