KEGG   Microbacterium sp. BH-3-3-3: BJP65_12855Help
Entry
BJP65_12855       CDS       T04827                                 

Definition
(GenBank) PucR family transcriptional regulator
  KO
K09684  PucR family transcriptional regulator, purine catabolism regulatory protein
Organism
mih  Microbacterium sp. BH-3-3-3
Brite
KEGG Orthology (KO) [BR:mih00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mih03000]
    BJP65_12855
Transcription factors [BR:mih03000]
 Prokaryotic type
  Other transcription factors
   Others
    BJP65_12855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PucR HTH_30 GGDEF_2 Sigma70_r4_2 HTH_23
Motif
Other DBs
NCBI-ProteinID: AOX46583
LinkDB All DBs
Position
complement(2790857..2792392)
Genome map
AA seq 511 aa AA seqDB search
MVDTAVAPPSLRALLARADLGLGLIVDEAALPTGSVDRPVRWVHSSDLADPTPFLSEGLV
LLTTGTQFADATPADYEAYVGRLLARGVRALGFGTEVVRDGIPAGLTAACLAAGMPLFEV
PYRTPFIAVARAGAEAIAADAYARRSWSLAAQRAVSLAALRPDGLAATLAELSRQLDCWV
GLFDAAGAVRTEYPVDALAPAALDAVTAEVTTMLHRGTRAASTLRIDGTAVSLQTLGRGG
HLRGALAIAADDLDHEARSVVTAVVAMAALVLEQQDGLSRAIGTFRAGLVQSLCTDDPAL
ARRASRDLFGPLPTAPVVVALTPATAARSGALAEWLEMRASERRGELFFGRGDDGFVVVV
PAAARGLLDEIADRFEIVVGCSTPTGYEAFSSALAQARTARERLSTPGVADFADTARAGL
LAALGSEAARSVAAGVLTPLRAHDEAQGSALLETVDAWLTHDCSHEATAQALGIHRHTVR
ARIAQAERVLGRDLSSFAARAETWTALRLAE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacaccgccgtcgccccaccgagcctgcgcgccctcctggctcgagccgacctg
ggcctgggcctgatcgtcgacgaggccgcccttcccaccggcagcgtggaccgccccgtg
cgatgggtgcactccagcgacctcgccgatcccactccgttcctcagcgaggggctggtg
ctgctgaccaccggcacccagttcgccgacgcgacccccgccgactacgaggcctacgtc
gggcgactgctcgcccgcggggtgcgggcgctgggattcggcaccgaggtcgtgcgcgac
ggcatccccgcggggctgaccgccgcgtgcctggccgcggggatgcccctgttcgaggtg
ccctaccgcacgccgttcatcgccgtggcccgcgccggagccgaggcgatcgccgccgac
gcctacgcccgccgcagctggtcgctcgccgcccagcgggccgtctcgctggcggcgctg
cgccccgacggtctggccgccaccctcgccgagctctcgcgacagctcgactgctgggtc
ggcctcttcgacgcggccggggccgtgcgcaccgagtaccccgtcgacgccctcgcccct
gcggcgctcgacgcggtgacggcggaggtgacgacgatgctgcaccgcggcacgcgcgcc
gcgtcgacgctgcggatcgacgggaccgcggtgagcctgcagaccctcggccggggcggg
catctgcgcggcgctctcgcgatcgccgccgacgacctcgaccacgaggcccgcagcgtg
gtgacggccgtggtggcgatggccgccctcgtcctcgagcagcaggatgggctgagccgc
gcgatcggtaccttccgcgcgggactcgtgcagtcgctgtgcaccgacgaccccgctctc
gcccgccgcgcgtcgcgggatctgttcggcccccttcccacggcccccgtggtggtggcg
ctcacccccgccacggccgcgcgctccggtgcgctggccgagtggctcgagatgcgtgcc
tcggaacggcggggggagctgttcttcggccggggcgacgacgggttcgtcgtggtcgtg
cccgccgcggcccgaggactgctcgacgagatcgcggaccgcttcgagatcgtcgtcgga
tgctccaccccgaccgggtacgaggcgttctcgagcgctctcgcgcaggcgcggaccgcg
cgcgagcggctctcgacccccggggtcgccgacttcgccgacacggcgcgggcgggactt
ctcgccgcgctcggctccgaagccgcccggagcgtcgccgcgggggtgctgacgcccctg
cgagcgcacgacgaggcgcagggctccgcactgctcgagaccgtcgacgcctggctcacc
cacgactgctcgcacgaggcgaccgcccaggctctcggcatccatcgccacaccgtgcgc
gcgcgcatcgcgcaggccgaacgggtgctcgggcgcgacctgtcgtcgttcgcggcgcgg
gcggagacctggacggcgttgcgtctggccgagtag

DBGET integrated database retrieval system