KEGG   Microbacterium sp. BH-3-3-3: BJP65_16080Help
Entry
BJP65_16080       CDS       T04827                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mih  Microbacterium sp. BH-3-3-3
Pathway
mih00473  D-Alanine metabolism
mih00550  Peptidoglycan biosynthesis
mih01100  Metabolic pathways
mih01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mih00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BJP65_16080
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJP65_16080
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BJP65_16080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mih01011]
    BJP65_16080
Enzymes [BR:mih01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BJP65_16080
Peptidoglycan biosynthesis and degradation proteins [BR:mih01011]
 Precursor biosynthesis
  Amino acid ligase
   BJP65_16080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AOX47104
LinkDB All DBs
Position
3492445..3493530
Genome map
AA seq 361 aa AA seqDB search
MTKPVVVVLFGGRSSEHSISSATAGGVLRSIDRERFEVIPVGITRDGAFVLEDDDPDKFA
LRPEALPQVVDNGTRVRMPDSTLSREWTVTDADGIRSLGDVDVVLPILHGRFGEDGTVQG
LLELLGIPYAGAGVLMSAIGMNKNVTKRVLRSANVPVVPWVAVTRADLARDRALWERRMR
ALDLPVFVKPNQAGSSVGVTKVSRWEDLDAALETAFAEDVLALVEQTIVGRELECGVLPG
RDGGAVRVSVAGEIVVTGREFYDFEAKYLDAPGVDLVCPAELGDGELAEMQRIAAQAFEA
IGGQGLARVDFFYTGTEFYVNEVNTMPGFTPISMFPTCWIASGLTYPDLISDLLDAALER
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaccggtggtggtggtgctcttcggcgggcgctccagcgagcattcgatcagt
tccgccacggcgggcggggttctgcggtcgatcgaccgtgagcgtttcgaggtgatcccc
gtcgggatcacccgcgacggcgccttcgtgctcgaagacgacgaccccgacaagttcgcc
ctgcgccccgaggccctgccccaggtggtcgacaacggcacccgcgtacggatgcccgac
tcgacgctctcacgggagtggacggtgacggatgccgatggcatccgctccctcggcgac
gtcgacgtggtgctgcccatcctccacggccgcttcggcgaagacggaacggtgcagggc
cttctcgagctgctcggcatcccctacgccggcgccggggtgctcatgtcggcgatcggg
atgaacaagaacgtcaccaagcgcgtgctgcgctcggcgaacgtcccggtcgtgccgtgg
gtcgcggtcacgcgcgccgacctcgcccgcgaccgggcgctgtgggagcgccgcatgcgg
gccctcgaccttccggtgttcgtgaagccgaaccaggccggctcgagcgtcggcgtcacg
aaggtgtcgcgctgggaagacctcgatgcggcgctcgagaccgccttcgccgaagacgtc
ctcgcgctcgtcgagcagaccatcgtcgggcgtgagctcgagtgcggcgtgctgcccggg
cgagacgggggagcggtgcgcgtgagcgtcgccggagagatcgtggtcacggggcgcgag
ttctacgacttcgaggccaagtacctcgatgcccccggcgtcgatctcgtgtgccccgcg
gagctcggcgacggcgagctcgccgagatgcagcgcatcgccgctcaggccttcgaggcg
atcggcgggcagggcctcgcgcgcgtcgacttcttctacaccggtaccgagttctacgtg
aacgaggtgaacacgatgccgggcttcaccccgatctcgatgttccccacctgttggatc
gcctcgggtctcacctatcccgacctgatcagcgaccttctcgacgcggcgctcgagcgg
gcctga

DBGET integrated database retrieval system