KEGG   Microbulbifer sp. A4B17: BTJ40_00135Help
Entry
BTJ40_00135       CDS       T05421                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mii  Microbulbifer sp. A4B17
Pathway
mii00380  Tryptophan metabolism
mii00630  Glyoxylate and dicarboxylate metabolism
mii01100  Metabolic pathways
mii01110  Biosynthesis of secondary metabolites
mii01130  Biosynthesis of antibiotics
mii01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BTJ40_00135
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BTJ40_00135
Enzymes [BR:mii01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BTJ40_00135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: AWF79365
UniProt: A0A2S1JLU3
LinkDB All DBs
Position
35071..36513
Genome map
AA seq 480 aa AA seqDB search
MADKPKLTTDAGAPVPDNQNSLTAGPNGPLLIQDYQLIEKLAHQNRERIPERAVHAKGWG
AYGVLRVTGDVSAYTCARVLQPGTETPLLARFSTVAGELGAADAERDVRGFALKFYTEEG
NWDLVGNNTPVFFVRDPYKFPDFIHTQKRHPRTHLRSPTAMWDFWSLCPESLHQVTILFS
DRGLPISPLHMNGYGSHTFSLWNHNGERFWVKFHFKTQQGHNYFTNAEAEEVIGRTRESY
QEAMYAAIENGECPKWTFQIQVMPEAEAGKTSYNPFDLTKVWPHGDYPPIEVGTMELNRN
PQDYFAEMEQAAFSPSNIVPGISFSPDKMLQARIFSYADAHRHRLGTHYESLPVNAPRCP
VHNYYRDGEMNSTGIRSGNPDAFYEPNSFSGPEEDLKAKEPPLPLSGAADRYDHRKGNDD
YTQVRALFDLFDDEQKQRLYSNIAEAMAGVPDDIVQRQLAQFAKVHTDYEEGVKLMMAKS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcggataaacccaaactcaccactgatgccggtgctcctgttccggataatcaaaac
agtctgacagcgggccccaatggtccattactgatccaggattatcagctaattgaaaag
ctggcccaccaaaatcgcgagcgtatacccgagcgggctgtgcacgccaagggttggggt
gcctacggggttttgagagtaactggtgatgtttctgcttatacctgtgcacgggtactg
cagccaggtacagaaaccccgcttttggcccgcttctcaactgtggctggtgaactgggc
gctgccgatgcagagagggatgtgcgtggttttgctctgaagttttatacagaggagggc
aactgggatttggtcggtaacaatacaccggtcttttttgtaagagatccctacaagttt
cccgattttatccacactcaaaagcggcatccgcgcacccacctgcgttcccctacggca
atgtgggatttctggtctctgtgcccggagagccttcaccaggtgaccatacttttttcc
gatcgtggcttgcctatatctccactgcatatgaacggttatggttcccatactttctca
ctatggaatcataacggagagcgtttctgggtcaaattccattttaagacccagcagggg
cacaattactttaccaatgcggaagccgaagaagtgattgggcgcacccgtgagagttat
caggaagctatgtatgcggcaatcgaaaatggggagtgtcccaaatggacattccagatt
caggtcatgccggaagcggaagccgggaaaacaagctataacccctttgacctaactaag
gtatggccccatggagattatccaccaattgaagtgggtaccatggagttgaatcgcaat
ccgcaagactattttgcggaaatggagcaggcggcattctcaccatccaatatcgtccca
ggtatcagtttctcaccagacaaaatgcttcaggcacgtattttttcctatgccgatgca
caccgtcaccgtttgggaactcattacgaaagtctcccagtgaatgcaccacgttgcccg
gtgcataattattatcgggatggtgaaatgaatagtacgggtattcgcagcggtaacccg
gatgctttttatgaacccaatagtttttctgggccggaggaggatttaaaagccaaagag
ccaccgctaccattatctggagcggctgacaggtatgatcaccgcaaaggtaatgacgat
tacacccaggtgcgagcgttgtttgatttatttgatgatgaacaaaagcagcgtttatac
agcaatattgcagaagcaatggcaggtgtaccggatgacatagttcagcgacaattggca
cagtttgccaaggtacacacagactatgaagagggtgtcaagttaatgatggctaaaagc
tga

DBGET integrated database retrieval system