KEGG   Microbulbifer sp. A4B17: BTJ40_00440
Entry
BTJ40_00440       CDS       T05421                                 

Definition
(GenBank) FAD-dependent oxidoreductase
Organism
mii  Microbulbifer sp. A4B17
SSDB
Motif
Pfam: Trp_halogenase FAD_binding_3 DAO FAD_oxidored Pyr_redox_2 Lycopene_cycl Pyr_redox HI0933_like FAD_binding_2 Thi4 Pyr_redox_3 GIDA NAD_binding_8 ApbA LPD26 3HCDH_N
Other DBs
NCBI-ProteinID: AWF79416
UniProt: A0A2S1JLY4
LinkDB
Position
93507..94736
AA seq 409 aa
MKEIKSDVVIIGAGPAGAIAGALLAKKGWQVSIVEREEFPRFSIGESLLAQCIEYLEKAD
MLEAVKSAGFQYKNGAAFEWDGARTSFDFREKFSPGHGTTFQVQRAKFDKILADEAERQG
VKVYYRHSVVSVDIAENNAKLIAENDGENLAFQARFVLDASGFGRVLPRLLDLDRPSEFP
VRESVFTHVEDNIDDSHFDRDKILITVHPSERDIWYWLIPFADGRASIGVVGEKEKISTW
GQDPEQILKGAIASAPELAKTLRNAKFDTEIQRICGYSSDVTKLAGPGFALLGNAGEFLD
PVFSSGVTIAMKSSELAVECLHRQLSEEAVDWDEEFVEPLKHGVEVFKTYVKAWYDGRFQ
DVIFYQTDQKEIKGMISSILAGYAWDKKNPFVAAAERRLNTLVEICSAK
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgaaagaaattaagtctgacgttgttattattggtgccggtcctgccggagctatcgca
ggtgcgttattggctaaaaaaggttggcaagtttcgatagttgagcgggaagaatttcct
cgcttttctattggcgaaagcctactggctcaatgtattgagtatttagaaaaagcagat
atgttagaagctgtgaaatcagcgggctttcaatataaaaatggtgctgcttttgagtgg
gatggtgctcgtacgtcatttgatttccgggagaagttctccccggggcatggcaccacc
ttccaggtacagcgggctaagtttgataaaatcctggctgatgaagccgagcgccaaggt
gttaaggtctattatcgccattctgtagtgtcagttgatattgctgagaataacgcaaaa
ttaatcgccgagaatgatggagaaaacctggctttccaggcgcgctttgtattggacgcc
agtggctttggcagagttttaccgcgattacttgatctcgatcgtccgtcagaatttcct
gttcgagaatccgtgtttacacatgttgaagacaatattgatgatagccattttgaccgg
gataaaatcttaatcactgtgcatcccagtgagcgggatatttggtattggttgattccc
tttgcagatggaagagcttctattggggttgtaggtgagaaagaaaagatttcgacctgg
gggcaggatccggaacagatattgaaaggggctattgcctccgcccccgagttggcaaaa
actctgcgcaatgccaaattcgatacggaaatacaacgtatttgcggatattccagtgat
gtgaccaaactggccggccctggttttgcgcttttggggaatgccggagagtttctagac
ccggtattttcatccggtgttaccattgcaatgaaatcctcagagttagcagttgagtgc
ctgcatcgccagctctcagaggaagcggttgattgggatgaagagtttgttgaacccctg
aagcacggtgtggaagtttttaaaacctatgtcaaagcttggtatgacggtcgttttcag
gatgtaattttttatcaaaccgatcaaaaagaaataaaaggcatgatttcctcaatcttg
gctggttatgcatgggataaaaaaaatccgtttgttgccgctgctgagcgtcgattgaat
acactggtagaaatatgttccgccaagtaa

DBGET integrated database retrieval system