KEGG   Microbulbifer sp. A4B17: BTJ40_02890Help
Entry
BTJ40_02890       CDS       T05421                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
mii  Microbulbifer sp. A4B17
Pathway
mii00061  Fatty acid biosynthesis
mii01100  Metabolic pathways
mii01212  Fatty acid metabolism
Module
mii_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mii00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BTJ40_02890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mii01004]
    BTJ40_02890
Enzymes [BR:mii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BTJ40_02890
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     BTJ40_02890
Lipid biosynthesis proteins [BR:mii01004]
 Fatty acid synthase
  Component type
   BTJ40_02890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AWF79847
UniProt: A0A2S1JN79
LinkDB All DBs
Position
complement(636535..637059)
Genome map
AA seq 174 aa AA seqDB search
MSNFVQKSEYTREELLTCSRGEMFGPGNAQLPAPNMLMLDRITHISKEGGAFGKGELIAE
LDIHPDLWFFDCHFPGDPVMPGCLGLDAMWQLLGYFLAWKGNPGRGRALGCGEVKFTGQI
LPTSKKVTYHIQMSRIVERRLVMGIGDGSVSVDGREIYTAKDLRVGLFTRTDNF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattttgtacaaaaaagtgagtataccagagaggagcttctgacctgctcccgt
ggcgagatgttcggcccaggcaacgcccagttgccggctcccaatatgttaatgcttgat
cgcataacccatatatctaaagaagggggcgccttcggcaagggagagctgatcgctgag
ctcgacattcaccccgatctatggtttttcgactgccactttcctggcgaccctgtaatg
cccggttgcttgggtctggatgccatgtggcaattactgggctacttcctagcctggaaa
ggaaatcccggccgcggtcgcgcactgggctgcggggaagttaaatttactggccagatc
ctccccaccagcaaaaaggtgacttaccatatccaaatgagccggattgttgagcgcagg
cttgttatgggtattggcgacggcagtgtctcagtggatggaagggaaatttacaccgct
aaggatcttcgcgtaggcttatttacccgtacggataatttttaa

DBGET integrated database retrieval system