KEGG   Microbulbifer sp. A4B17: BTJ40_09150
Entry
BTJ40_09150       CDS       T05421                                 

Definition
(GenBank) hypothetical protein
  KO
K22745  apoptosis-inducing factor 2
Organism
mii  Microbulbifer sp. A4B17
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox FAD_binding_3 Pyr_redox_3 DAO GIDA FAD_binding_2 AlaDh_PNT_C NAD_binding_8 3HCDH_N NAD_binding_7 Lycopene_cycl FAD_oxidored K_oxygenase HI0933_like NAD_binding_9 XdhC_C Thi4 DHFR_1 Trp_halogenase
Other DBs
NCBI-ProteinID: AWF80963
UniProt: A0A2S1JRG5
LinkDB
Position
complement(2014697..2015782)
AA seq 361 aa
MVIKAEVLIVGGGFAGVSVAQALERHGVHTILVDKKDYFEVTFATLRNVTDPSSTENQAR
KYYRDFFCGRFIQGDVVEMSAKSAHLADGTELHFDSAILASGTRYPNMSMAKSISAMDIQ
SRNQELLDVHQRLKQARKVMVIGGGVVGVELAGEIAHAMPITQVILAHNKDVLLDNFKPK
AQIKAQRQLENLGVEIQFNSRYQYQNGCYIDLNNGQASGADLVFEATGVLPNNDYLKPHL
AHILNEQGFVKVDNRLQVIDEPSLYALGDIADVGEAKLGYLASQQGEYLAKAIARNEKGK
STKSYKRSPLMALIPVGQKQGLVQLPFAVTTCNHLVRLKQKDLFINKVYRGFGTQPNARI
S
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggtaattaaagcggaagtattgatagtcggcggtggtttcgctggtgtgtctgtggcg
caagcactggaaaggcatggggtccataccatcctggtagacaaaaaagattatttcgaa
gtcacttttgccaccttgcgtaatgtaaccgatccatccagcaccgaaaatcaagcgcgc
aagtactatcgtgactttttctgtggccgcttcattcagggggatgtagtggaaatgtct
gctaagtcagcgcatttggcagatggaacagagttacattttgacagtgccatactcgct
tccggcacccgatatccgaacatgtcgatggccaaatccatttccgcgatggatattcaa
tccaggaaccaagaactgctggatgtgcatcagcgactgaaacaagcaaggaaagtcatg
gtgattggtggaggggtcgttggtgtcgaattggcaggagaaatcgcgcacgccatgcca
atcactcaagtaattctggcgcacaataaagatgtcttattggacaactttaagcctaaa
gcacagatcaaagcccagaggcaattagagaatttaggtgtagaaattcaattcaacagc
cgttaccaatatcaaaatggctgctatatcgatctcaacaacggccaagccagcggtgcg
gatctggtttttgaagcgaccggtgttttacccaacaatgattacctaaaaccgcactta
gcgcatatccttaatgagcagggatttgtgaaagtcgataataggcttcaagttattgac
gaaccaagcttgtatgcactgggagacattgcagatgtcggtgaggccaaactgggctac
ctcgcatcgcaacaaggtgaatatctggcaaaggccatcgccagaaatgaaaaaggaaaa
agtaccaaaagctataaacgaagcccgttaatggcattaattcccgtcggccagaagcaa
ggtttagtgcagctacctttcgcagtaacaacctgcaaccacctcgtgcggttgaagcag
aaagacctattcattaataaggtttatcgtgggtttggcactcagccaaatgcccggatc
tcctag

DBGET integrated database retrieval system