KEGG   Microbulbifer sp. A4B17: BTJ40_10125
Entry
BTJ40_10125       CDS       T05421                                 

Gene name
trxB
Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
mii  Microbulbifer sp. A4B17
Pathway
mii00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:mii00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BTJ40_10125 (trxB)
Enzymes [BR:mii01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     BTJ40_10125 (trxB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like FAD_oxidored NAD_binding_7 NAD_binding_8 K_oxygenase Thi4 Shikimate_DH
Other DBs
NCBI-ProteinID: AWF81145
UniProt: A0A2S1JRV8
LinkDB
Position
complement(2245225..2246172)
AA seq 315 aa
MSNKHHRLIILGSGPAGYTAAIYAARANLNPVVITGMQQGGQLTTTTEVENWPGGIPELQ
GPDLMVQMQQHAERFETEIIFDHIESVDLKERPFTLKGNETYTCDSLIIATGASAQYLGL
PSEEAFQGRGVSACATCDGFFYRDQKVAVVGGGNTAVEEALYLSNIASEVTLIHRRDELR
AEKILQDRLMDKVENGNINVCWHNTLDEVLGDDNGVTGVRLRSTKDDSTQELDVSGVFIA
IGHKPNTGIFEGQLEMNGGYLIVESGLNGNATQTSVPGVFAAGDVSDHIYRQAVTSAGTG
CMAALDAERFLDAEK
NT seq 948 nt   +upstreamnt  +downstreamnt
atgagcaataagcatcatcgactgatcatcctcggctcaggccccgccggctatacggca
gcgatttacgctgcccgcgcaaacctgaatccagttgttatcactggtatgcagcagggt
ggccagctgaccactaccactgaagtggaaaactggccaggcggtattccggaacttcaa
ggtccggatctgatggtgcaaatgcaacaacacgcagagcgatttgaaacagaaatcatc
ttcgatcacatcgaatcggttgacctcaaagagcgcccgttcaccctgaaaggtaacgaa
acctacacttgcgactctctgattattgccaccggcgcctctgctcagtacctgggcctc
ccttccgaagaggctttccagggtcgcggcgtcagcgcctgtgcaacctgtgacggcttt
ttctatcgcgaccagaaagttgctgttgtgggcggtggtaacaccgctgttgaggaagct
ttgtatctctccaatatcgccagtgaagtgaccttgattcaccgtcgcgacgagctgcgt
gcagagaaaatccttcaggaccgcctgatggataaagtggaaaacggcaatatcaacgtt
tgctggcacaataccctggacgaggttctcggggatgataatggtgtaaccggagtgcgc
ctgcgcagcaccaaggatgactccacccaggaactggacgtctctggcgtatttattgct
atcggtcacaagccaaacacaggtatctttgaaggccagcttgaaatgaatggtggttac
ctcattgtggagagcggcctgaatggcaatgccacccagacctctgttcccggtgtattt
gccgcaggtgacgtatccgaccatatttaccgccaagctgtgacttctgcgggtaccggc
tgtatggccgccctggacgccgagcgcttcctcgacgccgagaagtaa

DBGET integrated database retrieval system