KEGG   Microbulbifer sp. A4B17: BTJ40_10340Help
Entry
BTJ40_10340       CDS       T05421                                 

Gene name
cobS
Definition
(GenBank) adenosylcobinamide-GDP ribazoletransferase
  KO
K02233  adenosylcobinamide-GDP ribazoletransferase [EC:2.7.8.26]
Organism
mii  Microbulbifer sp. A4B17
Pathway
mii00860  Porphyrin and chlorophyll metabolism
mii01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mii00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BTJ40_10340 (cobS)
Enzymes [BR:mii01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.26  adenosylcobinamide-GDP ribazoletransferase
     BTJ40_10340 (cobS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobS Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: AWF81184
UniProt: A0A2S1JRZ2
LinkDB All DBs
Position
2294334..2295167
Genome map
AA seq 277 aa AA seqDB search
MFIARKLYNLSQAFLYALVFLTRLPVAGLLREVDKETVKRSIYFYPLVGVVIGVLLSGAA
YLLAPLGIQLQAAILLGFWVVLTGALHLDGLADCTDAYFAGHKCADPEEQRQHILRVMHD
PHCGSIAVAAVVVFLLIKFAAIAALLELINPVTKDAWVYLPLVLSPMLARAAALALMGIS
QYARVEGHVPPSGSERRWDLLPVVAIVVAIGCLAAPIPIAIGIVCSLIALVLFWRRLWDK
AIGGYTGDCLGGLVEISELSILILWVAVVANVNYGVV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgcccgtaagttgtacaacctatcccaagcatttctgtatgcgctggtattt
cttacccggctgccggtggcgggcttgctgcgggaggtggacaaggaaacggtgaagcgg
tcgatatatttttaccccctggttggagtggtgattggtgtactgttatctggggccgcc
taccttctggctcctttaggtattcagttacaagccgcaatactattgggtttctgggtg
gtcctgacaggtgcacttcatctcgatggccttgctgactgtactgatgcctattttgct
ggacataagtgtgccgatcctgaagaacaacgtcagcatattttgagggtaatgcacgat
ccccactgcggctctattgctgtagcggctgttgttgttttcctactgataaagttcgct
gcaattgcagccctgctagagctaataaacccggtaacaaaagatgcttgggtctatctg
ccgttggtgctctcacctatgctagccagggctgcggccctggctttaatgggaatttca
caatacgcacgtgttgaaggccatgtaccgccctctggctccgaacgccgatgggaccta
ttgccggtagttgcaatcgtagttgctattggatgtttagcggcgccaatacccattgct
ataggcatcgtctgtagtttgattgccctggttttattctggcgtcgcctgtgggataag
gctattggtggttataccggcgattgtttgggcggtttggttgagataagtgagttgtcg
atattgatattatgggtggcagtggttgccaatgtgaattacggagttgtttag

DBGET integrated database retrieval system