KEGG   Microbulbifer sp. A4B17: BTJ40_13115
Entry
BTJ40_13115       CDS       T05421                                 

Definition
(GenBank) thioredoxin reductase
Organism
mii  Microbulbifer sp. A4B17
SSDB
Motif
Pfam: Pyr_redox_2 FAD_binding_2 Pyr_redox_3 DAO HI0933_like GIDA Lycopene_cycl NAD_binding_9 NAD_binding_8 FAD_binding_3 FAD_oxidored AlaDh_PNT_C Thi4 Pyr_redox EPSP_synthase
Other DBs
NCBI-ProteinID: AWF81691
UniProt: A0A2S1JTF3
LinkDB
Position
complement(2946678..2947577)
AA seq 299 aa
MDTDVLIIGGSFAGLSAAMQLVRGRRKVVVLDANKPRNRFAKASHGVFCLDGKTPGEIRA
TALTQLKAYSSFQLVEGAADSVEIQEEGFAVTGQGDSTFKAKRLILATGISDQLPDIPGV
KKRWGRSVIHCPYCHGYELSDRPLGVLATSELSFHQAAMIPDWGATTLFTQGQFNPEGEV
LDHLLARGVMLEKAPITQLEGEGDSLSEVVLADGRRVPLEGLYVSPKAEMSSPFISQLGL
ELEESFTGWIVKVDPFKETSERGVFAAGDLSNPMQSGTFAIASGTMAGVGAHRSLIFNQ
NT seq 900 nt   +upstreamnt  +downstreamnt
gtggatacggatgtattgatcatcggtggtagttttgccggtttatctgcggctatgcag
cttgttcgtgggcggcgaaaggtcgtcgtgttggatgccaataaaccccgaaatcgcttt
gcgaaggcctctcatggtgtattttgcctggatggtaagactccaggggagatccgcgcc
acggccttaacccagctgaaggcatattcgagctttcaattggttgaaggtgccgcggac
agtgtggagattcaggaagagggttttgctgttactggacagggtgatagcacttttaag
gcgaagaggctgattctggcaactggtatttcggatcaactgcccgatattccaggggta
aagaagcgctggggtaggagtgtgattcactgtccctattgccacggttatgagctgagt
gatcgccctttaggtgtgctggctaccagtgagctgtctttccatcaggcggcgatgatt
cccgattggggcgctaccaccttgtttacccaggggcagtttaatcctgagggtgaggtg
ctagatcacttgttggctcgaggagtgatgctggagaaagctccaattacccagctggaa
ggagagggggatagcttaagtgaagttgttttagcggatggccgcagggtgccactggag
gggctctatgtgagtcctaaagctgagatgtcttccccttttatcagccaattggggctg
gaattggaggagtcgtttactggatggattgtaaaagtggatccctttaaggagacttct
gaaaggggggtctttgctgcaggggatttatccaatccgatgcaaagcggaaccttcgcg
atagcatccggtaccatggcgggtgtcggagcccatcgctcgttgatatttaaccagtga

DBGET integrated database retrieval system