KEGG   Microbulbifer sp. A4B17: BTJ40_14595Help
Entry
BTJ40_14595       CDS       T05421                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mii  Microbulbifer sp. A4B17
Brite
KEGG Orthology (KO) [BR:mii00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BTJ40_14595
Enzymes [BR:mii01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BTJ40_14595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored Thi4 Glutaredoxin NAD_binding_8 AlaDh_PNT_C K_oxygenase FAD_binding_3 FMO-like DUF2190 DUF3053
Motif
Other DBs
NCBI-ProteinID: AWF81954
UniProt: A0A2S1JU65
LinkDB All DBs
Position
3301806..3303356
Genome map
AA seq 516 aa AA seqDB search
MLDANLKKQLDTYLQNIVKPIEIRVSTDNSEKSKELEALVDEISGLSNKITAQQGQAKRT
PSMAIAPAGEEPRISFAGIPLGHEFTSLVLALLQAGGHPSKADPKLLEQVRNLKGEFHFE
TYISLSCQNCPDVVQALNLMATLNPNITHEMIDGGLFQAEVEKRNVMAVPAVYLNGEHFG
QGRMSLEEIVGKLDTGAAERKAEELNEKAPYDLLVVGGGPAGAAAAIYAARKGIRTGIVA
ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVKEYGVDIITDQLAANLRRNEMVDIK
LQSGATLSSRSVVLATGARWRELGVPGEAEYRTKGVAYCPHCDGPFFKGKRVAVIGGGNS
GIEAAIDLAGIVEHVTVLEFADKLRADEVLVRKAQLMNNIDIIVNAQTTEVLGDGNKVNG
LAYTDRETGENKQLDLAGVFVQIGLVPNTEFLKETDVEMNRIGEIVIDERGATSVPGVYA
AGDATTVPYKQIVISMGAGATAALGAFDYLIRSSVE
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcaaacctgaaaaaacaactggacacttacctgcagaatatcgtcaagccg
atcgagattcgtgtgtccacagataacagtgaaaaatccaaagagctggaagccctggta
gatgaaatctccgggctctccaacaagattactgcgcagcagggccaggccaagcgcacg
ccgagtatggccatcgctcctgccggagaggaaccccggattagctttgccggcattccc
ctgggacatgaatttacctcacttgtactggcactattgcaagcgggaggccatccctca
aaagcagacccgaagctactggagcaggtgcgaaacctgaaaggtgaattccactttgaa
acctatatctcgctctcttgccagaactgcccggatgttgtccaagcgctgaacctaatg
gcaaccctcaacccaaacatcacccacgaaatgatcgacggtggcctgttccaggcggag
gttgaaaagcgcaatgtaatggcggtacctgcggtctacctcaatggtgagcacttcggc
cagggcagaatgtcccttgaggaaattgtcggaaaactggataccggcgcagcagaacgc
aaagctgaagagctgaatgaaaaagcaccctacgatcttttagtcgtagggggtggccca
gcgggcgcggcagccgctatttatgccgcacgcaaaggcattcgcaccggcatagtggca
gagcgcttcggcggccaggtgatggataccgtaggcatcgaaaactttatctctgtacct
tacaccgaaggccccaagctcgcagccagccttgagcaacatgttaaagagtatggtgtc
gatattattaccgaccaactcgcagccaacttgcgacgcaacgaaatggtagatatcaaa
ctacaaagcggtgcgaccctatccagtcgctctgtagtattggccaccggtgcccgctgg
agagaactgggggtacctggagaagcggagtaccgcaccaagggcgtagcctactgcccc
cactgtgacggccccttctttaaaggtaagcgtgtagccgtgattggcggcggtaactcg
ggcatcgaagcagcgatcgacctcgccggaatcgtagagcacgttaccgtactggaattc
gccgataaactgcgtgcagacgaggtattggtacgcaaagctcagctgatgaacaacatc
gatattatcgtcaatgctcaaaccaccgaagtcctcggcgacgggaacaaagtgaacggc
ctggcctataccgatcgagagaccggcgaaaataaacagctcgacctggctggtgttttc
gtacagattggcctggtacctaatacggagttccttaaagaaaccgatgtggagatgaat
cgcataggcgaaattgtgatcgacgagcgcggcgcaacttcagtccccggcgtttacgcc
gccggcgatgcgactacagtcccctacaaacagatagtgatctctatgggtgcaggtgca
actgcggcgctgggcgcatttgactacctgattcgatcttcggttgaataa

DBGET integrated database retrieval system