KEGG   Microbulbifer sp. A4B17: BTJ40_15630
Entry
BTJ40_15630       CDS       T05421                                 

Definition
(GenBank) hypothetical protein
  KO
K22745  apoptosis-inducing factor 2
Organism
mii  Microbulbifer sp. A4B17
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 FAD_binding_3 DAO Lycopene_cycl NAD_binding_7 FAD_oxidored FAD_binding_2 NAD_binding_8 3HCDH_N GIDA K_oxygenase Thi4 TrkA_N HI0933_like AlaDh_PNT_C Trp_halogenase 2-Hacid_dh_C Sacchrp_dh_NADP ApbA NAD_binding_9 DUF1188 Shikimate_DH UDPG_MGDP_dh_N XdhC_C adh_short_C2
Other DBs
NCBI-ProteinID: AWF82146
UniProt: A0A2S1JUQ9
LinkDB
Position
complement(3550111..3551193)
AA seq 360 aa
MIKRTDVLIVGGGFAGVSVAQKLAKQGMQVVLVDRKDHFEVTFATLRNAIAPSLLTANPR
KYYRDFIQSDFVQADVVSMDDRIAKSSNGLEIHFKQAVIATGSRYPTLPIAKSTSAYTIS
EREQEMRNEQKILSKSQSVLIVGGGTVGVELAGEISSAYPNKTVTLVHSKDVLLGHLKPK
AQNKALEQLTAKGVSVHLNTRLVKEGAIYRSMNTQETFKADLVYECVGMSPNTEFLKTEL
PGVLDKMGLIKVDEYMRVRGYSNLYAIGDCSTLDENKHGYIANVQGGILASVIINQAKGK
KVKPYKTPSYAIVTPTGTETGVAQMPFGVFTSKLFVNLKQKDMGIGHMLKASGTTPDLLS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgatcaaacggacagacgtgttaatcgttggcggaggctttgctggtgtttctgtggct
caaaagttagctaagcagggtatgcaggtggtgttggttgatcgaaaggaccattttgaa
gtgacctttgccacattgcgtaatgcgatagcgcctagcttactgactgctaatccacgt
aagtattatcgtgactttattcagagtgattttgttcaagcagatgtggtttccatggat
gaccggatagcaaagtcatcgaatggattagagatccactttaagcaggcagttatcgcg
acaggtagccgctacccaaccttgccgatagctaaatccacatcagcttatacaatttcc
gagcgtgagcaagaaatgcggaatgagcaaaaaatactgtcgaaatctcagtcagttttg
attgtaggaggcggtaccgttggcgtggagctggccggggaaattagcagcgcttatccc
aataaaaccgtgacgttagtccattctaaagatgtactacttggccatcttaagcctaaa
gctcagaacaaggcgctagaacagcttacggctaagggtgttagcgtacatctcaatacc
cggctagttaaggaaggtgcaatttaccgttctatgaatactcaagaaactttcaaggca
gacctggtttatgaatgtgtaggtatgtcgccaaataccgagtttctaaaaacagaatta
cccggtgtgttagataagatgggattaattaaagtggacgaatatatgcgggttaggggt
tattctaacctttatgcgataggtgattgctctactctggatgaaaataagcacggctat
atagcaaacgttcaaggaggcatcttagcgagcgttatcattaatcaagccaaaggtaaa
aaggttaagccttataaaacacctagttatgccattgttacgccgaccggtacagagaca
ggtgtagctcaaatgccttttggtgtttttacttcaaagctatttgttaacctgaaacaa
aaagacatggggataggccatatgcttaaagcaagcggtacaactccagacttacttagc
tag

DBGET integrated database retrieval system