KEGG   Microbulbifer sp. A4B17: BTJ40_16730
Entry
BTJ40_16730       CDS       T05421                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mii  Microbulbifer sp. A4B17
Pathway
mii00020  Citrate cycle (TCA cycle)
mii00190  Oxidative phosphorylation
mii00650  Butanoate metabolism
mii01100  Metabolic pathways
mii01110  Biosynthesis of secondary metabolites
mii01120  Microbial metabolism in diverse environments
mii01200  Carbon metabolism
Module
mii_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mii_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mii_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTJ40_16730
   00650 Butanoate metabolism
    BTJ40_16730
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BTJ40_16730
Enzymes [BR:mii01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BTJ40_16730
    1.3.5.4  fumarate reductase (quinol)
     BTJ40_16730
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA DAO HI0933_like Thi4 Pyr_redox_3 FAD_oxidored
Other DBs
NCBI-ProteinID: AWF82339
UniProt: A0A2S1JVA8
LinkDB
Position
complement(3805824..3807596)
AA seq 590 aa
MANMRTISFDGIVIGGGGAGMRAALQMAQSGYKTAVITKVFPTRSHTVSAQGGITCAIAS
SDPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTEEGRIYQRP
FGGQSKDFGRGGQAARTCAAADRTGHALLHTLYQNNVKHKTEFLNEWFAIDLVKNQDGAV
VGVIAMCIEDGEVVYIKSKATVFATGGAGRIFASTTNAHINTGDGVGMALRAGMPVQDIE
MWQFHPTGIYGAGVLVTEGCRGEGGYLINKDGERFMERYAPNAKDLASRDVVARSMVLEI
LDGRGCGPEGDHVFLKLDHLGEELLNSRLPGICELSKTFAHADPVKVPIPVVPTCHYMMG
GIPTNVHGQALTQDAAGNDQIIDGFYACGEVACVSVHGANRLGGNSLLDLVVFGRASGLF
IEKSLREGIEHREASESDLEAAMARLNRLETNETGEKASDLRKELQGVMQNHFGVFRRGD
FMAEGVKKLADLRERIENVRLDDRSRAFNTARVEALELQNLLEVAEATAVAAETRTESRG
AHAREDFQERDDENWLCHSMYFPAEKRVGKRAVNFAPNTMEAFEPKARTY
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggcgaacatgcgtactatttcttttgacgggattgtaattggtggtggcggtgccggt
atgcgcgctgccctgcagatggcccagtccggctataaaactgcggttattaccaaagta
ttcccgacgcgttctcacacggtatctgcccagggcggaattacctgtgcgatcgccagc
tcagatcccaacgacgattggcgctggcacatgtacgataccgttaaaggttccgactac
attggtgaccaggacgctatcgaatatatgtgttccgtaggccctgaggcagtatttgag
cttgagcacatggggctgcccttctctcgtacagaggaaggccgcatctatcagcgcccc
ttcggcggtcagtccaaagatttcggccgcggtggccaggctgcacgtacctgtgccgct
gctgaccgtaccggccatgcactgctgcatactctctatcaaaacaacgttaagcacaaa
accgaattcctgaacgaatggtttgcgattgacctggtgaagaaccaggacggtgctgtt
gtgggtgtgatcgccatgtgcatcgaagatggcgaagtggtttatatcaaatccaaagcg
actgtattcgctactggcggtgccggtcgtatcttcgcttccaccaccaacgcacacatc
aataccggtgacggtgtcggtatggccctgcgtgccggtatgccggtccaggatattgag
atgtggcagttccaccccactggtatttacggtgccggtgtactcgtgactgaaggttgt
cgcggtgaaggtggctatctgatcaataaagatggcgagcgtttcatggagcgctacgcg
cctaacgccaaagacctcgcttcccgcgacgttgtggctcgctctatggttctcgagatt
ctcgacggtcgcggttgtggtccggaaggcgatcacgtattcctaaagctcgaccatctg
ggtgaggaattgctcaacagccgcttgcccggtatctgtgaactgtccaagactttcgcc
cacgccgacccggttaaggtgccgatcccggtagtacctacctgtcactatatgatgggt
ggtattccgactaacgttcacggtcaggctttgactcaggacgctgccggtaacgaccag
attatcgatggtttctacgcctgtggtgaggttgcctgcgtatctgtacacggtgctaac
cgtctgggtggtaactcactgctggatctggtggtgttcggtcgcgcttccggtctgttt
atcgagaaatccctgcgtgagggtatcgagcaccgcgaagcttcagagtccgatctcgaa
gccgcaatggctcgcctgaatcgcctggagaccaacgagaccggtgagaaggcttcggac
ctgcgcaaagagctgcagggtgtgatgcaaaaccattttggtgtcttccgccgcggcgac
tttatggctgaaggcgtgaagaaacttgcagatctgcgcgagcgtattgaaaatgtacgc
ctcgacgaccggagccgagccttcaatactgcccgtgttgaagcactggaactgcagaac
ttactggaagttgccgaggccactgcggttgccgcagagactcgaacagaaagtcgtggt
gctcacgcccgcgaggacttccaggagcgcgatgatgaaaactggctgtgccactctatg
tatttccctgcggaaaaacgtgttggcaagcgtgcggtaaacttcgcgcctaacactatg
gaagcctttgaaccgaaagctcggacttactga

DBGET integrated database retrieval system