KEGG   Microbulbifer sp. A4B17: BTJ40_18005
Entry
BTJ40_18005       CDS       T05421                                 

Definition
(GenBank) FAD-dependent hydroxylase
  KO
K18800  2-polyprenylphenol 6-hydroxylase [EC:1.14.13.240]
Organism
mii  Microbulbifer sp. A4B17
Pathway
mii00130  Ubiquinone and other terpenoid-quinone biosynthesis
mii01100  Metabolic pathways
mii01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mii00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BTJ40_18005
Enzymes [BR:mii01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.240  2-polyprenylphenol 6-hydroxylase
     BTJ40_18005
SSDB
Motif
Pfam: FAD_binding_3 DAO Lycopene_cycl Thi4 Pyr_redox Pyr_redox_2 NAD_binding_8 FAD_binding_2 HI0933_like FAD_oxidored Pyr_redox_3 SE 3HCDH_N GIDA ApbA K_oxygenase NAD_Gly3P_dh_N TrkA_N NAD_binding_9 UDPG_MGDP_dh_N Shikimate_DH NAD_binding_7 XdhC_C IlvN 2-Hacid_dh_C F420_oxidored Trp_halogenase
Other DBs
NCBI-ProteinID: AWF82546
UniProt: A0A2S1JVW3
LinkDB
Position
complement(4085904..4087070)
AA seq 388 aa
MTESDVAIVGAGPAGLSLAVMLARKGCQVVIIERQDKSALSAPVDDGREIALTHKSYKLL
QELGAWQRLSPEEISPLNAAEVVDGNSPSTLHFSPGEKGPLGFIVSNSAIRRILYETVLE
AENIALLDNSTVTGMTLSGAMRHLELAEGEGVRASLVVAADSRFSEVRRMAGIGADMRDF
GRVAIVGPVRTALPHDGIARECFRYGSTLALLPLPKPNISSAVVTVPASLSAQIMAMGND
EFAGHVSRESASQLGSVKAFGERHCYPLVAVYAHHFFTERFALVGDAAVGMHPVTAHGFN
LGLAGADTLARQLDSVSRLYNPAKLTRALARYQMLHRVESKPIYSGTNRVVDLFTDDRLP
AKLLRKMVLRVSDRFPPIRKAIVHQLTR
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgacggagtccgatgtagctatcgtaggtgctggaccggctgggctttccttggcggtg
atgctcgcccgtaaagggtgtcaggtagtaattattgagcgccaggataagtcggcgctg
tccgctcccgttgacgatggtcgcgagattgccctgacacacaaatcctacaagctgctg
caagaactgggggcctggcagagattatccccggaagagatcagtccactaaatgctgcc
gaagtagtcgatggcaattccccttcgacactccactttagcccgggagagaaggggccc
ctgggttttattgtctccaactctgcgatccggcgaatcttatatgagacagttttggag
gccgagaatatagcgctgcttgataactcaactgttaccgggatgacattgagcggtgct
atgcgtcatcttgagctggcagagggggagggcgtgcgcgcttccctggtggttgcggcc
gatagtcgtttttctgaagtgcggcgcatggcgggcattggcgccgatatgcgcgacttt
ggccgagtggcgattgttggccctgtacgcaccgcattgccccacgatggtattgcccgg
gagtgtttccgctacggctcgacactggcactgctgcctttgcccaagccaaatatttca
tcggccgtggttactgttcccgccagcctctctgcccaaattatggcgatgggtaatgat
gagttcgccgggcacgtatctcgcgaaagtgcgtcccagctcggcagtgtcaaagctttt
ggcgagcgccactgttatccattggttgcggtatacgcacatcactttttcactgagcgc
tttgccttggtgggagatgccgctgtggggatgcatccagtgactgcacatggatttaat
ttgggcttagccggtgcggatactttggcccgccaactggatagcgttagtcgtctatat
aatccagccaagctgactcgggccctggcccgttaccagatgctgcaccgggttgaatcc
aagccgatttactctgggactaatagggtggtggatttatttactgacgatcgcttaccg
gccaagttgctgcgcaaaatggtgttgcgagtcagtgatcgcttcccccctattcgaaaa
gcaatagtgcaccagttaacccgctag

DBGET integrated database retrieval system