KEGG   Microbulbifer sp. A4B17: BTJ40_18965
Entry
BTJ40_18965       CDS       T05421                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mii  Microbulbifer sp. A4B17
Pathway
mii00473  D-Alanine metabolism
mii00550  Peptidoglycan biosynthesis
mii01100  Metabolic pathways
mii01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mii00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BTJ40_18965
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTJ40_18965
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BTJ40_18965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mii01011]
    BTJ40_18965
Enzymes [BR:mii01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BTJ40_18965
Peptidoglycan biosynthesis and degradation proteins [BR:mii01011]
 Precursor biosynthesis
  Amino acid ligase
   BTJ40_18965
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp
Other DBs
NCBI-ProteinID: AWF82725
UniProt: A0A2S1JWE3
LinkDB
Position
4311021..4312031
AA seq 336 aa
MINTLLICGGGGSEHDVSLRTADFIENKLSAAEDIALLRVEMDSSGCLTDSQGRVYHIFY
DRKIRDEEGNSWDVDYVIPAIHGYPGETGDLQSQLDMFGIPYFGSAPEPSKICFNKIKTK
MWLSALGIENTPYEFLHSLEDEELQKAHDALKNWGEVFVKASNQGSSVGCFKVSDKEELE
AAIEDAFRLSPYVLIEKALKARELEVAVYHYNNDVVATRPGEVRAPSDTFYTYKEKYAEG
SRAVTFIEAAGLHEEQLKWIAEVSLRTFKALKLKDLSRIDFFLTETGELYLNEVNTFPGM
TPNSMFPKMMENHGHNFTEYLTGLIRSAVSSSNPKT
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgattaacaccttgcttatctgcggcggtggcggcagcgagcacgacgtatccctcaga
accgctgattttatcgagaacaagttgtcagcggcagaggacattgccctactgcgggtg
gaaatggatagcagtggttgcctcaccgacagccaaggccgggtttaccatatcttttac
gatcgcaaaatccgcgatgaagaaggtaattcctgggatgttgactacgtaattcctgca
attcacggttacccaggagaaaccggcgatttacagtcgcaactggatatgttcggtatc
ccctatttcggttctgctccagaacccagcaaaatctgctttaacaaaattaaaaccaaa
atgtggctcagtgccctgggtattgagaataccccttatgagtttctgcacagcctggaa
gacgaagaactgcaaaaagcccacgatgcgctcaagaactggggcgaagtttttgttaaa
gcctccaaccaggggtcttccgttggctgtttcaaggtcagtgacaaggaggaactggag
gctgcgatagaggatgctttcagactctccccttatgtgctgatagaaaaagcgctaaaa
gccagggagctcgaggttgcggtttaccactacaataatgatgtcgtcgcaacccgcccg
ggagaggtgcgtgctccatcggatactttttacacctacaaggagaaatatgccgagggc
agccgcgcagtcacctttatcgaagctgcaggtctgcacgaagagcagctgaagtggatt
gccgaagtttccctgcgcacttttaaggccctgaagctcaaggatttgtcccgcatagac
tttttcctgacagagactggcgaactctacctcaatgaagtgaataccttccccggcatg
acccccaactccatgttccccaaaatgatggaaaaccatgggcacaatttcactgagtac
ctgactggactgattcgctctgcagtgtcttcatccaaccccaagacttaa

DBGET integrated database retrieval system