KEGG   Microbulbifer sp. A4B17: BTJ40_20070Help
Entry
BTJ40_20070       CDS       T05421                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
mii  Microbulbifer sp. A4B17
Pathway
mii00290  Valine, leucine and isoleucine biosynthesis
mii00770  Pantothenate and CoA biosynthesis
mii01100  Metabolic pathways
mii01110  Biosynthesis of secondary metabolites
mii01130  Biosynthesis of antibiotics
mii01210  2-Oxocarboxylic acid metabolism
mii01230  Biosynthesis of amino acids
Module
mii_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
mii_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mii00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BTJ40_20070
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BTJ40_20070
Enzymes [BR:mii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     BTJ40_20070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AWF82931
UniProt: A0A2S1JWZ1
LinkDB All DBs
Position
4595052..4596884
Genome map
AA seq 610 aa AA seqDB search
MPRYRSRTSTAGRNMAGARALWRATGMTDEDFHKPIIAIANSFTQFVPGHVHLKDMGQLV
AREIERAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIADSVEYMVNAHCADALVCIS
NCDKITPGMMMAAMRLNIPVIFVSGGPMEAGKTKLADHKLDLVDAMVIAATDTASDEEVA
EYERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGTMLATHADRKELFLRAGREIVTL
TKRYYEQDDESALPRNIANRTAFRNAMALDIAMGGSTNTILHLLATAQEGEIDFTLEDID
RLSREVPQLCKVAPNTEKYHIEDVHRAGGVMAILGELEAAGLIDSSLPTAYGGSLADALT
RWDICRTNDRSVLEFYRAGPAGIPTQTAFSQDCRWSTLDADRQHGCIRSAEHAYSSEGGL
AVLFGNLAPNGCVVKTSGVDESLWKFEGPAHVVESQEEAVSNILEGKVSKGEAVIVRYEG
PKGGPGMQEMLYPTSYLKSKGLGEHCALITDGRFSGGTSGLSIGHVSPEAASGGNIALVR
NGDLIRIDIPARKIEIVIEESELDKRRREMEAKPNGWKPIEKRPRKVSRALKAYAMLATS
ADRGAVREID
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgatatcgctcccgcacttctaccgccggtcgcaatatggccggagcccgcgcc
ttgtggcgtgctaccggtatgacggatgaggacttccacaagccgatcattgccattgcc
aactcttttacccagtttgttcccggccatgtgcacctgaaagatatggggcagcttgtc
gcaagggagattgagcgcgccggcggagtggccaaagagttcaatacaattgcagtggac
gacggtatcgcgatggggcatgacggcatgctctacagcttacccagccgcgaaatcatt
gctgactcagtcgaatacatggtcaatgcgcactgcgccgacgccttggtatgcatatcc
aactgcgacaagatcactccagggatgatgatggccgccatgcgcctgaatatcccggtg
atattcgtatctggcggccccatggaggctggtaaaaccaaactggcagaccacaagctc
gacctggtggacgctatggtgatcgccgctacagatacagcctctgacgaagaggttgca
gagtatgagcgctctgcttgcccgacctgtggctcctgctcaggaatgttcacagcaaac
tccatgaactgcctcacagaggccctggggctttcactgcctggcaatggcaccatgctc
gcgactcacgccgatcgcaaagagttattcctgcgcgctggccgcgagatcgtaaccctg
accaagcgctattacgaacaggatgatgagagcgccctgccgcgcaatatcgccaatcgc
acagccttccgaaatgccatggcactcgatatcgccatgggaggctccaccaatactatc
ctgcacctgctggcaaccgcccaggaaggtgaaattgatttcacccttgaagatatcgat
cgcctctcccgtgaggttccacagttgtgcaaagtagcccccaataccgagaaataccat
attgaggatgtgcaccgagccggtggtgtaatggctatcctcggggagctggaagcagct
gggcttatcgactcctcactacctaccgcttacggtggctcgctggccgatgccctgact
cgctgggatatttgccgcaccaacgacagatctgtacttgaattctaccgtgcagggccc
gcaggtatccccactcaaacggctttcagccaggactgccgctggtccactttagatgca
gatcgccagcacggctgcattcgctctgcggagcacgcctactcctctgagggagggctc
gctgttctgttcggcaatctggctcccaatggctgtgtggtaaaaacttccggcgtagat
gagtcactgtggaaatttgaaggcccggcccacgtagtagagagccaggaagaggcagtt
tccaatatcctcgaaggtaaggtcagtaaaggggaggctgttatcgttcgttatgagggc
cccaaaggtgggccgggaatgcaggaaatgctctaccccactagttacctaaagtctaaa
gggctcggtgaacactgtgcattgattaccgatggccgtttctcaggcggtacctcaggc
ctctctatcggacatgtatcaccggaagcggcatctggaggtaatatcgctctggttcgc
aatggagaccttatacgcattgatattccagcaaggaaaattgaaatcgttattgaggaa
agtgagctcgacaagcgacgccgggaaatggaagcaaaacccaatggctggaagcctatt
gagaagcgcccccgcaaggtcagcagggcactaaaagcctatgccatgctcgccaccagc
gctgaccggggagcagtgagagaaattgactga

DBGET integrated database retrieval system