KEGG   Microlunatus sp. KUDC0627: FOE78_19780Help
Entry
FOE78_19780       CDS       T06101                                 

Definition
(GenBank) GNAT family N-acetyltransferase
  KO
K22476  N-acetylglutamate synthase [EC:2.3.1.1]
Organism
mik  Microlunatus sp. KUDC0627
Pathway
mik00220  Arginine biosynthesis
mik01100  Metabolic pathways
mik01110  Biosynthesis of secondary metabolites
mik01130  Biosynthesis of antibiotics
mik01210  2-Oxocarboxylic acid metabolism
mik01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mik00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    FOE78_19780
Enzymes [BR:mik01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     FOE78_19780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 FR47 Acetyltransf_10 Acetyltransf_7 Acetyltransf_3 DDE_Tnp_1_assoc Acetyltransf_8 Acetyltransf_13 GNAT_acetyltran Acetyltransf_6
Motif
Other DBs
NCBI-ProteinID: QDP97846
LinkDB All DBs
Position
4355481..4356497
Genome map
AA seq 338 aa AA seqDB search
MDQTPPRAIGADALSAMVPPLGIDDRVTIRYRLTDGSATDVVGWVVGLDDDQVRVQPPAP
DGRPQPALVDRDRIILAKRVPPVPGGRPVSRTTAEELERIAMQGWIDESAPLLPGHHGWT
LRFGNGFTGRANSCLAVGDPGLPYPEASKLIIEQYQAAGLPPWVQVITDSVPDRRLVDLG
WQPTYVPTTVMTGTLGAVVGDHRRTDRVQVAEQLTEDWWQGYLQYRPIPDHETARRILIN
NPPVGLASVHHDGRLVALGRGQITADWLGIAGLWTDPAFRRQGLATMIIRELAHWAARRG
ARYGYLQVAQENAGAIAAYSRLGFVRHHDYRYLAPAPV
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggaccagacaccgccccgcgcgatcggagccgacgcgctgtccgcaatggtgccaccg
ctggggatcgacgaccgggtgaccattcgctaccgcctcaccgacggttcggcgaccgac
gtggtgggctgggtggtcgggctcgacgacgaccaggtacgagtacagccgcccgccccg
gacggtcgtccacagccggcgctggtggatcgcgatcggatcatcctggccaagcgcgtg
ccaccggtccccggcggtcgtccggtgagcaggacgacggccgaggaactggaacggatc
gcgatgcagggctggatcgacgagtccgcacccctgctgcccgggcatcacggatggacg
ctgcgcttcggcaacggcttcaccggacgggccaattcctgtttggcagtaggcgatccg
ggacttccctatcccgaggcgtcgaagttgatcatcgagcagtaccaggccgcggggctg
ccgccgtgggtgcaggtgatcaccgactcggtgccggaccgccgacttgttgatcttggt
tggcagccgacctacgtgccgaccacggtgatgacgggcacgctcggcgcggtggtcggt
gatcatcggcgcaccgaccgagtgcaggtcgccgagcagctcaccgaggactggtggcag
ggctatctgcagtaccggccgattcccgatcatgaaaccgcgcgccggatcttgatcaac
aatccaccggtcggactggcatcggtgcaccacgacggccggctggtcgcgctgggacgt
ggccagatcaccgccgactggctcggcatcgccggcctgtggaccgatccggcgttccgt
cgtcaaggcctggcgaccatgatcatccgcgagctcgcgcactgggcagcccggcgcggc
gcccgctacggctatctgcaggtggcccaggagaacgccggcgccattgctgcctactcg
cggctcggcttcgtacgccatcacgattaccgctacctcgcaccggcgccggtctaa

DBGET integrated database retrieval system