KEGG   Micromonospora sp. L5: ML5_0474Help
Entry
ML5_0474          CDS       T01379                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mil  Micromonospora sp. L5
Pathway
mil00020  Citrate cycle (TCA cycle)
mil00480  Glutathione metabolism
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
mil01120  Microbial metabolism in diverse environments
mil01130  Biosynthesis of antibiotics
mil01200  Carbon metabolism
mil01210  2-Oxocarboxylic acid metabolism
mil01230  Biosynthesis of amino acids
Module
mil_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mil_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ML5_0474
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ML5_0474
Enzymes [BR:mil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ML5_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ADU06025
LinkDB All DBs
Position
complement(484191..485408)
Genome map
AA seq 405 aa AA seqDB search
MAKIKVNNPVVEIDGDEMTRIIWKQIREQLILPYLDVDLHYYDLSIQHRDATDDQVTVDA
ANAIKEHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIMSNVPRL
VPGWTKPIIIGRHAHGDQYKATDFVVPGPGTVTITYTPADGGTPMEMEVANFPGGGIAMG
MYNYDESIRDFARASFRYGLDRGYPVYMSTKNTILKAYDGRFKDIFAEVFENEFKAEFEA
AGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLSPDGR
TVEAEAAHGTVTRHYRQYQKGEKTSTNPIASIYAWTRGLAHRGKLDGTPAVTEFADTLEK
VIVDTVEGGQMTKDLALLISRDAPWLTTDEFMNALDENLARKLAA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtaaacaacccggtcgtggagatcgacggcgacgagatgacccgg
atcatctggaagcagatccgggagcagctgatcctgccctacctcgacgtcgacctgcac
tactacgacctgtcgatccagcaccgtgacgccaccgacgaccaggtcacggtcgacgcc
gccaacgccatcaaggagcacggcgtcggcgtcaagtgcgccaccatcaccccggacgag
gcccgggtggaggagttcggcctgaagaagatgtggcggtcgccgaacggcaccatccgc
aacatcctcggcggcgtggtcttccgcgagccgatcatcatgtcgaacgtgccgcggctc
gtcccgggctggaccaagccgatcatcatcggccgccacgcgcacggcgaccagtacaag
gccaccgacttcgtcgtccccggccccggcactgtgaccatcacctacaccccggccgac
ggcggcacgccgatggagatggaggtcgccaacttccccggcggcggcatcgccatgggc
atgtacaactacgacgagtcgatccgggacttcgcccgcgcctcgttccggtacggcctg
gaccgcggctacccggtctacatgtcgaccaagaacaccatcctcaaggcgtacgacggc
cggttcaaggacatcttcgccgaggtgttcgagaacgagttcaaggccgagttcgaggcc
gccggcctcacctacgagcaccggctgatcgacgacatggtcgccgccgcgctcaagtgg
gagggcggatacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacaccgtc
gcgcagggcttcggctcgctcggcctgatgacctcggtgctgctgtccccggacggccgc
accgtcgaggccgaggccgcccacggcaccgtcacccggcactaccggcagtaccagaag
ggcgagaagacctcgaccaacccgatcgcctcgatctacgcctggacccggggcctggcc
caccggggcaagctggacggcaccccggcggtcaccgagttcgccgacacgctggagaag
gtcatcgtggacaccgtcgagggtggccagatgaccaaggacctcgcgctgctcatctcg
cgggacgccccgtggctgaccaccgacgagttcatgaacgcgctcgacgagaacctggcg
cgcaagctcgccgcctga

DBGET integrated database retrieval system