KEGG   Micromonospora sp. L5: ML5_1906Help
Entry
ML5_1906          CDS       T01379                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
mil  Micromonospora sp. L5
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ADU07434
LinkDB All DBs
Position
complement(1964252..1965364)
Genome map
AA seq 370 aa AA seqDB search
MDLPINPPVEPMLAKSVAELPTDAGLTYEPKWDGFRCIVFRDGDEVELASRGGKSMTRYF
PEVVEQARRQLPARCAVDGELIVIRRDGPGGQPRLDFELLAQRIHPAASRVKLLAETTPA
DFVAFDLLAIDDELLVDQPYPRRRERLEQALSGVRPPVHVTQVTTDPETARRWFDVFEGA
GLDGLIVKPADLPYEPGKRLMFKVKHARTMDAVVAGFRWHKSGPVVGSLLLGLYDDSGVL
HHIGVSSSFTMARRKELLDELEPYRDVGGEHPWVHGDHERGQRIPGGVSRWTGGKNLEWE
PLRPALVVEVAYDAMEGDRLRHTARFLRWRPDRDPRSCDYGQLDRPIRYDVDEVLRGDPA
ATVGDTRGRA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgccgatcaaccctccggtcgagccgatgctcgccaagagcgtcgccgagctg
cccaccgatgccggtctgacctacgagccgaagtgggacggcttccgctgcatcgtgttc
cgcgacggcgacgaggtcgagctggccagccggggcggcaagtcgatgacgcgctacttc
cccgaggtggtcgagcaggcccgccggcagctcccggcccggtgcgcggtcgacggcgag
ctgatcgtgatccgccgggacggcccgggtgggcagcctcggctcgacttcgagctgctg
gcccagcggatccatccggccgcctcccgggtgaagctgctggccgagaccaccccggcc
gacttcgtcgcgttcgacctgctggcgatcgacgacgagctgctcgtcgaccagccctat
ccccggcggcgggagcggctggagcaggcgctgtccggggtgcgcccgccggtgcacgtg
acgcaggtgaccaccgacccggagacggcccggcgctggttcgacgtgttcgagggcgcc
gggctggacgggctgatcgtcaagccggccgacctgccgtacgagccgggcaagcggctc
atgttcaaggtcaagcacgcccgcacgatggacgcggtggtggccggtttccgttggcac
aagtccggtccggtggtcggctcgctgctgctcggcctctacgacgacagcggcgtgctg
caccacatcggcgtcagctcctcgttcaccatggcccgccgcaaggagctgctcgacgag
ctggagccctaccgcgacgtcggcggcgagcacccgtgggtgcacggcgaccacgagcgg
ggccagcgcatcccgggcggggtgagccggtggaccggcggcaagaacctggagtgggag
ccgctgcgtccggcactggtggtcgaggtggcgtacgacgcgatggagggcgaccggctg
cggcacaccgcccggttcctgcgctggcgacccgaccgtgatccccgctcctgcgactac
ggtcagctcgaccgcccgatccgctacgacgtcgacgaggtgctgcgcggcgatccggca
gcgacggtcggtgacacccgcggccgggcgtag

DBGET integrated database retrieval system