KEGG   Micromonospora sp. L5: ML5_2501Help
Entry
ML5_2501          CDS       T01379                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mil  Micromonospora sp. L5
Pathway
mil00010  Glycolysis / Gluconeogenesis
mil00071  Fatty acid degradation
mil00350  Tyrosine metabolism
mil00625  Chloroalkane and chloroalkene degradation
mil00626  Naphthalene degradation
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
mil01120  Microbial metabolism in diverse environments
mil01130  Biosynthesis of antibiotics
mil01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ML5_2501
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ML5_2501
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ML5_2501
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ML5_2501
   00626 Naphthalene degradation
    ML5_2501
Enzymes [BR:mil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ML5_2501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_31 CoA_binding Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ADU08023
LinkDB All DBs
Position
complement(2597720..2598730)
Genome map
AA seq 336 aa AA seqDB search
MRASVVTAFDRPMEITERPVPEVGPGEILVRIEASGLCHTDIHAARGEWPVKPTPPFVPG
HEGVGLVEQVGPGVTEHAVGDRVALPWLGWACGTCKYCVTGWETLCESQRNTGYSIDGAH
AEYAVAAARYAVRVPDGVDPFEAAPLTCAGVTTYKAVKVAGVRPGERVAIFGIGGLGHLA
QQYAQIFGAETIAVDVTTEKLELATSLGAAHTVDAATTDPVERITALGGVDVAIVLAASP
RVIEQAHRSLRRGGRLVLVSLPADNAITLPVFETVLKGITVLGSIVGTRADLAEVFALHA
AGRTRVVYETRKLDDINDAVDDVLAGRVAARLVLQP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccagtgtcgtcaccgcgttcgaccgtccgatggagatcaccgagcgtcccgtg
ccggaggtcggcccgggcgagatcctggtccgcatcgaagccagcggactctgccacacc
gacatccacgccgcccgcggcgagtggccggtgaagcccactccgccgttcgtccccgga
cacgagggcgtcggcctggtcgagcaggtcggccccggcgtcaccgagcacgccgtcggc
gaccgcgtcgcgctgccctggctcggctgggcctgcggcacctgcaagtactgcgtgacc
ggctgggagacgctgtgcgagtcgcagcgcaacaccggctacagcatcgacggcgcgcac
gccgagtacgcggtcgccgccgcccggtacgcggtgcgcgtgcccgacggcgtggacccg
ttcgaggccgcgccgctgacctgcgcgggcgtcaccacgtacaaggccgtcaaggtcgcc
ggggtgcggccgggcgagcgggtcgcgatcttcggcatcggcggcctggggcacctcgcc
cagcagtacgcccagatcttcggcgccgagacgatcgcggtggacgtgaccaccgagaag
ctggaactggccacctcgctcggcgccgcgcacacggtcgacgccgccaccaccgacccg
gtcgagcggatcaccgcgctgggcggcgtggacgtggcgatcgtgctcgccgcgagccct
cgggtcatcgagcaggcgcaccgctcgctgcgccgcggcggccggctggtgctggtgtcg
ctgcccgccgacaacgcgatcaccctgcccgtcttcgagacggtactcaagggcatcacg
gtgctcggctcgatcgtcggcacccgcgccgacctggccgaggtcttcgcgctgcacgcc
gccggccgcacccgggtcgtctacgagacccgcaagctggacgacatcaacgacgcggtg
gacgacgtcctcgccggccgggtcgccgcccggctcgtgctccagccctga

DBGET integrated database retrieval system