KEGG   Micromonospora sp. L5: ML5_3057Help
Entry
ML5_3057          CDS       T01379                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
mil  Micromonospora sp. L5
Brite
KEGG Orthology (KO) [BR:mil00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ML5_3057
Enzymes [BR:mil01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ML5_3057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A BtrH_N
Motif
Other DBs
NCBI-ProteinID: ADU08574
LinkDB All DBs
Position
complement(3203888..3204292)
Genome map
AA seq 134 aa AA seqDB search
MRLPRILTPRVTASAHCDLPCGVYDPAQARIEAESVKMICEKYQANTDPEFRTRAILIKE
QRAELVKHHLWVLWTDYFKAPHFEKYPHLHQLFNEATKLAGAAGAKGGTDPAKADELLAK
IDEISKIFWETKQA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttccccgcatcctcacgccccgggtgacggccagcgctcactgcgacctgccc
tgcggcgtatacgacccggcccaggcccggatcgaggccgagtcggtcaaaatgatctgc
gagaagtaccaggccaacaccgacccggagttccgcacccgcgccatcctgatcaaggag
cagcgggcggaactggtcaagcaccacctgtgggtgctctggaccgactacttcaaggcg
ccgcacttcgagaagtacccgcacctgcaccagctgttcaacgaggccaccaagctggcc
ggcgcggccggcgccaagggcggcaccgacccggccaaggccgacgagctgctggcgaag
atcgacgagatctcgaagatcttctgggagaccaagcaggcgtga

DBGET integrated database retrieval system