KEGG   Micromonospora sp. L5: ML5_3107Help
Entry
ML5_3107          CDS       T01379                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mil  Micromonospora sp. L5
Pathway
mil00500  Starch and sucrose metabolism
mil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ML5_3107
Enzymes [BR:mil01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ML5_3107
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     ML5_3107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase GHL5
Motif
Other DBs
NCBI-ProteinID: ADU08624
LinkDB All DBs
Position
3261248..3262900
Genome map
AA seq 550 aa AA seqDB search
MGDRWYQEAVVYCLDVDTYADSDGDGVGDFQGLIGRLDYLARLGVTCLWLNPIHPSPNED
DGYDATDFYNVDPRLGTLGDFAELLHQASNRGIRVIIDLVVNHTSDQHPWFQSARSSPDS
PYRDWYVWADHEPDDRHQGMVFPGEQHETWTYDRTAKAWYYHRFYKFQPDLNIENPKVRA
EIKKITSFWLQLGVSGFRMDAVPFIIERTEPGNPNSPKDFDFLTDLRQHVQWRRGDAVLL
AEANVEPDELPVYFGDGSGSGNRIHMLFDFMLNGRLMLALAREDPEVIIEALRDTPKLPT
GGQWATFLRNHDEIDLSRLTADQRNDVLAKFGPDENMQLYGRGIRRRLAPMLGNDRRHME
LAYSLQFSLRGTPVLRYGEEIGMGENLSLDGRDAIRTPMQWSYADNAGFSTAEPEKLVRP
VIDKGEYGYQKVNVTAQRKDPRSLLGWFERMIRTLREAPETGSGSTTHIDVPMPPGVLAH
RADGRTGTMVFLHNLGTEDVEVDLSTLAPEADLPIDVLSDRNYEDVGKLDRLKLGGYGYR
WIRLCRGHER
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacaggtggtatcaggaggcggtcgtctactgcctcgacgtcgacacgtacgcg
gactccgacggcgacggggtgggtgacttccaggggctgatcggccggctggactacctg
gcccggctcggcgtgacctgcctgtggctgaacccgatccacccctcgccgaacgaggac
gacgggtacgacgccacggacttctacaacgtcgacccgcgcctgggcacgctcggcgac
ttcgccgagctgctgcaccaggcgagcaacaggggcatccgggtgatcatcgacctggtg
gtcaaccacacctcggaccagcacccgtggttccagtccgcccggtcctcgcccgactcg
ccgtaccgggactggtacgtctgggccgaccacgagccggacgaccgccaccagggcatg
gtcttccccggcgagcagcacgagacgtggacctacgaccggaccgccaaggcgtggtac
taccaccgcttctacaagttccagccggacctgaacatcgagaacccgaaggtccgcgcg
gagatcaagaagatcacctcgttctggctccagctcggcgtctccggtttccggatggac
gcggtgccgttcatcatcgagcgcaccgagccgggcaacccgaactcgccgaaggacttc
gacttcctcaccgacctgcgccagcacgtgcagtggcggcgcggcgacgcggtcctgctg
gccgaggcgaacgtcgagccggacgagctgcccgtctacttcggcgacggcagcggctcg
ggcaaccggatccacatgctcttcgacttcatgctcaacggccggctgatgctcgccctg
gcccgggaggacccggaggtgatcatcgaggcgttgcgcgacaccccgaagctgcccacc
ggcggccagtgggcgacgttcctgcgcaaccacgacgagatcgacctgtcccggctcacc
gccgaccagcgcaacgacgtgctggcgaagttcgggccggacgagaacatgcagctctac
ggccggggcatccgccgtcgtctcgcgcccatgctcggcaacgaccgccggcacatggag
ctggcgtactcgctccagttctcgctgcgcggcacgccggtgctgcgctacggcgaggag
atcggcatgggggagaacctgtcgctggacgggcgcgacgcgatccgtaccccgatgcag
tggtcgtacgcggacaacgccgggttctccacggccgagccggagaagctggtccgcccg
gtgatcgacaagggcgagtacggctaccagaaggtcaacgtcaccgcccagcgcaaggat
ccgcggtcgctgctcggctggttcgagcggatgatccggacgctgcgcgaggcgccggag
accggctcgggcagcaccacccacatcgacgtgccgatgccgccgggcgtgctcgcgcac
cgcgccgacggtcgtaccgggaccatggtcttcctgcacaacctcggcaccgaagacgtc
gaggtcgacctgagcacgctggcgccggaggcggacctgccgatcgacgtgctcagcgac
cgcaactacgaggacgtgggcaagctcgaccggctcaagctcggcgggtacggctaccgg
tggatccggctctgccggggccacgagcggtag

DBGET integrated database retrieval system