KEGG   Micromonospora sp. L5: ML5_3461
Entry
ML5_3461          CDS       T01379                                 

Definition
(GenBank) undecaprenyl diphosphate synthase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
mil  Micromonospora sp. L5
Pathway
mil00900  Terpenoid backbone biosynthesis
mil01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mil00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ML5_3461
Enzymes [BR:mil01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     ML5_3461
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: ADU08975
LinkDB
Position
3640696..3641508
AA seq 270 aa
MIRSTRATRREPVPPTPHPSGARPPALPPAAVPRHVAIVMDGNGRWAKERGLPRTKGHEQ
GEHSLFDAVEGAIEMGIPYLSAYAFSTENWRRSPDEVRFLMGFNRDVIRRRRDQLVDLGV
RVVWSGRAGRLWKSVISELQTAEEMSRGNSTLTLQFCVNYGGQAEIADAAAGIARDVAAG
RLDPAKVNEKTVARYLYHPEVPEVDLFLRPSGEQRISNFLLWQTAYAELVYLDTLWPDFD
RRHLWYACELYAQRDRRFGGALPNPVAPGA
NT seq 813 nt   +upstreamnt  +downstreamnt
gtgatccgatcgacgagggcgacccgccgcgagccggtgccgccgaccccgcacccctcc
ggcgcccgtccgccggcgctgccgcccgccgcggtgccccggcacgtcgccatcgtgatg
gacggcaacggccgctgggccaaggagcgcgggctgccccgcaccaaggggcacgagcag
ggcgagcacagcctgttcgacgccgtcgagggcgcgatcgagatggggatcccctacctg
tcggcgtacgcgttctccaccgagaactggcggcgctcgccggacgaggtccgcttcctg
atgggcttcaacagggacgtcatccgccgccgccgcgaccagctcgtcgacctgggcgtc
cgggtggtctggtcgggccgtgccggccggctgtggaagagcgtcatctccgagttgcag
accgccgaggagatgtcgcgcggcaactcgacgctgacgctgcagttctgcgtcaactac
ggcggccaggcggagatcgccgacgccgccgccgggatcgcccgcgacgtcgcggccggc
aggctcgacccggccaaggtgaacgagaagacggtggcgcgctacctctaccaccccgag
gtgcccgaggtcgacctgttcctgcgcccctccggcgagcagcgcatctccaacttcctg
ctctggcagaccgcgtacgccgagctggtctacctggacacgctctggcccgacttcgac
cgccgtcacctctggtacgcctgcgagctgtacgcccagcgcgaccgccgcttcggcggc
gccctgcccaacccggtcgccccgggcgcctga

DBGET integrated database retrieval system