KEGG   Micromonospora sp. L5: ML5_3556Help
Entry
ML5_3556          CDS       T01379                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mil  Micromonospora sp. L5
Pathway
mil00500  Starch and sucrose metabolism
mil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ML5_3556
Enzymes [BR:mil01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ML5_3556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase EAL
Motif
Other DBs
NCBI-ProteinID: ADU09070
LinkDB All DBs
Position
complement(3734705..3736150)
Genome map
AA seq 481 aa AA seqDB search
MHRRRCRAAALALGLAASLLVPLTAAAPPAAAATPGAKKVIVQLFEWNWTSVAAECTSTL
GPKGYGYVQVSPPQEHVNSSPWWVSYQPVSYRIESRKGTRAQFQSMVNTCHAAGVKVIVD
AVVNHMSGQENGGTGWAGSSYGHYNYPGVYSAQDFHYCGRNGNNDIANYNDRYEVQNCEL
VNLADLKTESEYVRGRLAAYLNDLLSLGVDGFRLDGSKHMPAADIAAIKAKLNRSAYLVQ
EVIYGAGEPIQPTEYTGNGDVHEFRYGKDLARMFNNERLAYLRNFGESWGYLSSAKAVVF
TDNHDTQREGGVLTYRNRGTYALANAFMLAWPYGTPAVMSSFTYSGRDQGPPADGSNRIT
NVTCYSGWECEHRWPVIANMVGFRNATEGAGVSNWYDNGYQHIAFSRTGKGYLTINDEDG
AVNGRSYYTGLPAGRYCDVIHGTFSNGSCSGPVITVDSSGWFAANIAAHDGIAIHIGAKL
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgacgccgatgccgcgccgccgcgctcgccctgggtctggccgcgagtctgctc
gtccccctcaccgcggcggcacccccggccgccgccgccacccccggcgccaagaaggtc
atcgtccagctcttcgagtggaactggacctcggttgccgccgagtgcaccagcacgctg
ggcccgaagggctacggctacgtgcaggtgtccccgccccaggagcacgtcaacagcagc
ccgtggtgggtgtcgtaccagccggtcagctaccggatcgagtcccgcaagggcacccgc
gcgcagttccagtccatggtgaacacctgtcacgccgcgggcgtcaaggtgatcgtcgac
gccgtggtcaaccacatgtccggccaggagaacggcggcaccggctgggccggctcgtcg
tacggccactacaactacccgggcgtctactcggcgcaggacttccactactgcggccgc
aacggcaacaacgacatcgccaactacaacgaccggtacgaggtgcagaactgcgagctg
gtgaacctcgccgacctcaagaccgagtcggagtacgtgcgcggccggctggccgcgtac
ctcaacgacctgctctcgctcggcgtcgacggtttccgcctggacggcagcaagcacatg
ccggccgccgacatcgccgcgatcaaggccaagctgaaccgcagcgcgtacctggtgcag
gaggtcatctacggcgccggtgagccgatccagccgaccgagtacaccggcaacggcgac
gtgcacgagttccggtacggcaaggacctggcccggatgttcaacaacgagcgcctcgcg
tatctgcggaacttcggcgagtcctggggctacctgtcgagcgcgaaggcggtggtcttc
accgacaaccacgacacccagcgcgagggcggcgttctcacctaccgcaaccgcggcacg
tacgcgctcgccaacgcgttcatgctggcctggccgtacggcaccccggcggtgatgtcg
agcttcacgtacagcggccgggaccagggcccgcccgccgacggcagcaaccggatcacc
aacgtcacctgctactcgggctgggagtgcgagcaccgctggccggtcatcgccaacatg
gtcggcttccgcaacgccaccgagggcgccggggtctccaactggtacgacaacggctac
cagcacatcgcgttcagccgtaccggcaagggctacctgacgatcaacgacgaggacggc
gcggtgaacggccggtcgtactacaccgggctgccggcgggccgctactgcgacgtcatc
cacggcacgttcagcaacggctcgtgcagcggcccggtgatcaccgtggactcgtccggc
tggttcgccgcgaacatcgccgcgcacgacgggatcgccatccacatcggcgcgaagctc
agctga

DBGET integrated database retrieval system