KEGG   Micromonospora sp. L5: ML5_4063Help
Entry
ML5_4063          CDS       T01379                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mil  Micromonospora sp. L5
Pathway
mil00061  Fatty acid biosynthesis
mil00780  Biotin metabolism
mil01100  Metabolic pathways
mil01130  Biosynthesis of antibiotics
mil01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mil00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ML5_4063
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ML5_4063
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ML5_4063
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mil01004]
    ML5_4063
Enzymes [BR:mil01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ML5_4063
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ML5_4063
Lipid biosynthesis proteins [BR:mil01004]
 Fatty acid synthase
  Component type
   ML5_4063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ADU09573
LinkDB All DBs
Position
4286110..4286877
Genome map
AA seq 255 aa AA seqDB search
MSGLLAGKRLLVTGVITDASIAFSVAKLAQENGAQVVLTGYGRLSLVERIAKRLPEPAPV
IELDVSNEEHLAGLADKVREHVDGLDGVVHSIGFAPQSCLGGGFLDAPWADVATALQVST
YSYKSLAMAALPLMSAGGAVVGLTFDATKAWPVYDWMGVAKAGLESASRYLALHLGKQGI
RSNLVAAGPLRTIAAKSIPGFDRFEDAWTERAPLGWSLTDQEPAARACLALLSDWFPATT
GEIVHVDGGYHAIGA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtccggacttctcgccggtaagcggctgctggtcaccggcgtcatcaccgacgcgtcg
atcgccttctcggtggcgaagctcgcccaggagaacggcgcccaggtcgtgctcaccggc
tacggccggctctccctggtggagcggatcgccaagcggttgcccgagccggcgcccgtg
atcgagctggacgtcagcaacgaggagcacctggccgggctggccgacaaggtgcgcgag
cacgtcgacggcctggacggcgtcgtgcactcgatcgggttcgccccgcagagctgcctc
ggcggcggtttcctcgacgccccctgggcggacgtggcgacagcgctccaggtctccacc
tactcgtacaagtccctcgccatggccgcgctgccgctgatgtccgccgggggcgccgtg
gtgggcctcacgttcgacgccaccaaggcgtggccggtctacgactggatgggcgtggcc
aaggccgggctggagtccgcctcccgctatctggcgctgcacctgggcaagcagggcatc
cgcagcaacctggtcgcggccggcccgctgcggaccatcgcggccaagtccatccccggc
ttcgaccggttcgaggacgcctggaccgagcgcgccccgctgggctggagcctcaccgac
caggagcccgccgcgcgggcctgcctggcgctgctgtccgactggttcccggccaccacc
ggcgagatcgtccacgtcgacggcggctaccacgccatcggcgcctga

DBGET integrated database retrieval system