KEGG   Micromonospora sp. L5: ML5_4437
Entry
ML5_4437          CDS       T01379                                 

Definition
(GenBank) Methyltransferase type 12
  KO
K13307  dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.235]
Organism
mil  Micromonospora sp. L5
Pathway
mil00523  Polyketide sugar unit biosynthesis
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mil00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ML5_4437
Enzymes [BR:mil01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.235  dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     ML5_4437
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_31 Methyltransf_12 NodS Methyltransf_2 Methyltransf_15 Ubie_methyltran tRNA_U5-meth_tr TPMT MetW
Other DBs
NCBI-ProteinID: ADU09914
LinkDB
Position
4715847..4716599
AA seq 250 aa
MTTSVPAAGMYGEEQAEVYELVHRARGKDYDEEAAFVAEQARALLPGAATLLDVACGTGA
HLRAFARLFDRVEGLELSPAMVEAARTNTPGAVVHHGDMRSFHLGERYDVITCMFGSVGY
LTDVEELNAALRRFAAHLSPGGVVAIDPWWFPDTYLDGYVSASLVEADGTTVVRVSHSKR
DGDASRMEVHYIVARPTGGVHHFVEQHRITLFPRDTYEKAFRGAGLSVRYLEGSQSGRGL
FVGCAGHQED
NT seq 753 nt   +upstreamnt  +downstreamnt
atgacgacatcggtgccggcggccggcatgtacggcgaggaacaggccgaggtgtacgag
ctggtgcaccgtgcccgaggcaaggattacgacgaggaggccgcgttcgtcgccgagcag
gcgcgggcgttgctgcccggcgctgcgaccctgctcgacgtcgcctgcggcaccggtgcg
cacctgcgcgcgttcgctcgcctcttcgaccgggtggagggcctggaactgtcccctgcg
atggtcgaggcggcccgcacgaacaccccgggggcggtcgtgcaccacggcgacatgcgc
tccttccatctcggcgagcggtacgacgtgatcacctgcatgttcggctccgtgggctac
ctcaccgacgtcgaggagctgaacgcggccctgcggcgcttcgcggcgcacctctcgccc
ggcggtgtggtcgcgatcgacccttggtggttcccggacacctacctcgacggatacgtg
tcggcctccctcgtcgaggccgacgggacgaccgtcgtacgcgtctcgcactccaagcgc
gacggcgacgcttcccgaatggaggtccactacatcgtcgctcgccccaccggcggcgtc
caccacttcgtcgagcagcatcgcatcacgctcttcccccgcgacacgtatgagaaggca
ttccggggcgcgggattgagcgtgcgctacctcgagggcagccagtcgggccgtggcctc
ttcgtcggctgtgccggacaccaggaggactga

DBGET integrated database retrieval system