KEGG   Micromonospora sp. L5: ML5_5893Help
Entry
ML5_5893          CDS       T01379                                 

Definition
(GenBank) Beta-ketoacyl synthase
Organism
mil  Micromonospora sp. L5
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR PS-DH Ketoacyl-synt_C KAsynt_C_assoc PP-binding adh_short Docking Thiolase_N Epimerase Polysacc_synt_2 GDP_Man_Dehyd SAT NmrA
Motif
Other DBs
NCBI-ProteinID: ADU11350
LinkDB All DBs
Position
complement(6398220..6409169)
Genome map
AA seq 3649 aa AA seqDB search
MADEAKLLDYLKRVTADLHQVRQRLREVEAGEQEPVAIVSMSCRFPGGVRSPEDLWEVVA
SGRDVVSDFPTDRGWDVGSLYDSDPEQAGTSYTRQGGFVHDLADFDPGFFAISPREALAM
DPQQRWLLETSWEALERAGIDPHSLRGSRTGVFAGSTGQDYGTVLMGAAQGLEGHLMTGN
AGSVVSGRIAYTFGLEGPAVTIDTACSSSLVALHLAGQALRQQECTLAIVAGVTAMCTPA
AFVEFSRQRGLAADGRCKAFAAAADGTGWSEGVGVLVLERLSDAQRNGHPILAVVRGSAV
NQDGASNGLSAPNGPSQQRVIQQALANAGLAAGGVDVVEAHGTGTRLGDPIEAQALLATY
GQERGDSAPLLLGSVKSNIGHAQAAAGVAGVIKMVMAMRHGVVPPTLHVDEPTPEVDWSA
GDVSLVTEATPWPAVDRPRRSAVSSFGVSGTNAHTILEQAPAPQPAPSATAPVVERPVVP
VPVSARDAAGLAAQAARWAARIAADETLRPLDVAFSSVTSRSTLDHRAVVHATGREDLLA
GLRALAAGQPSGAVVAGQAGGRGSLAVLFSGQGAQRAGMGRELYVGFPVFAATLDEVCVY
LDALLPRPLREVLFALEGSAEAALLDQTVFTQAGLFAVEVALFRLVESLGIAPEFVGGHS
IGEVTAAYVAGVLSLADACALVAARGRLMQALPAGGGMLAVAADEVAVVESIAGSTDRVG
IAAVNGPTSVVVSGAVDALDEVERVWRERGVRTRRLTVSHAFHSPLMEPMLAEFRAVLDG
LTFSAPSLPVVSNVTGALADADEIRTADYWVRHVREAVRFADGVTALRAAGADTFLEVGP
RSVLTAMVGEILPADDAVLAVAAQRKDRPEVHGLLAGLAELHVHGVAVDWRQWFAETGAR
RVDLPTYAFQHQRYWPEAGAGWTGDVTAVGLRPAQHPLLGAAVGVAHAEGFLFTGRLARR
THPWICDHVVFDTVLLPGTGFVELALQAGGHVGADHVRELTLESPLILPETGGVDIQLWI
GPADETGCRSVSLHSAQDGEPTEGTGERAWTRNASGVLASGPAVPSGPAGWSDLTTWPPP
GATEVGTDDLYLNLAAQGYDYGPSFIALRSAWRRGDDLFAELALPEAPAAEAAGYGLHPA
LLDAALHTLGLTTPAGEPSGAGMPPGFGRLPFSWNDVALHGAGAAAARVRVSHTGPDSIS
LLLTDVTGAPVISVGSLVLRPVSADQLRTASGGGTESLFRVEWAPLALPAGPSTVDWAVL
GDAAALTDAVAATGTAVAAYPDLAALATAMDGGTDAPGVLVLPLLDPPASADVPRAVAEA
THRVLAVLQQFLAEERYAVSRLVVLTSGAVATDRDTDLTDLAGAAVIGLLRSAQSENPDR
FVLVDVDDVAGCAAALVPAVATDEPQVVIRAGVAAGARLTRGAAPTEPPAAPFDSDGTVL
ITGATGTLGRLMSRHLVSTYGVRRLILTSRRGRAAEGVAELCAELEALGVRVTVAACDVA
DRGAVAELLAGIPAEHPLTAVIHAAGVRDDGVISSLTPERMDGVLRPKVDAAWHLHELTA
DLELKAFVSYSSLAATAGGPGQGNYAAANAFLDGLAQHRKARGLAALTLAWGLWADRSGM
TTELDDVHLNRISRSGVAAMEAEEGLALFDAACRTTDAALVPARLDLAAMKVQFAGGTIP
PLYRALIRTPARAAAASTGASLVQQLAGLGDAERAAALVEIVRGQAAAVLGYPDPAAIEP
RRAFSEFGFDSLTAVEMRNRLNNAFGMRLPATLVFDYPTPHDLAAFLGTEIAGTPVPVRP
TTTAVSVGDDEPLAIIGMACRLPGGVWSPDDLWRLVVDGVDAISDLPTDRGWDLDSLYSP
DPDAPGTFYARGGGFLSGVDRFDPNFFGISPREALAMDPQQRLLLETTWESFESAGIDPT
DVRGSSTGVFVGTSGQDYGSLLAYSPEAAEGYMLTGMTSSVISGRVAYTFGLEGPAVSLD
TACSSSLVALHWAGQALRRGECDMALAGGVMVMATPTAFVEFSRQRGLAADGRCKSFAAS
ADGTGWSEGVGMLLVQRLSDARRQGRTVYAVVRGSAINSDGASNGLTAPNGPSQQRVIRQ
ALASARLTTADVDVVEAHGTGTTLGDPIEAQALLATYGRERPADRPLLLGSIKSNIGHAQ
AAAGVAGVIKMVQAIRHGLVPATLHVDEPSPHIDWTSGAVELATQSRPWPAVDRPRRAAV
SSFGISGTNAHVIIEQADELSVAPAEPGPGLVASDAVLWPLSGRSKGALAGQAARLAEYV
RERGDIDAAAVGWSLATTRSAFGHRAAVVGSGTEELLAGLDAVASGTPAGNVVADTTTSH
GAGPVFVFPGQGAQSARMAAGLVGRTPVFDARLAECQRALAPYLDVDLVSVLTGEDESWL
ERVEVVQPVLWAVGVALAAVWQYAGVTPAAVIGHSQGEIGAACVAGILSIEDAAKAVALR
SRALTVLRGTGTMASVDLSAESVAERLPAFPGVGVAAVNGPSTVVVSGPPQPVADLVEAC
QADGVRARLIPVDYASHSAAVQDVAEQLRADLADVTPQPGHTRLVSTLTGDWVDPASMTA
DYWYENLRQTVQFDAAVRVAVAAGHTTFVEISPHPVLAMPVTAILDDAGVSGHTLGSLRR
GDDDATRLLTNLATAHTIGLPVDLTAVLAETDTVALPTYAFDHQRYWVEPPVHRAQDVAS
AGLQDAGHPLLSAALTFPDSERMVFTGRLSVRTHPWLGEHRVMDNILLPGTAFVELATYA
GEQAGCPTVEELTLLAPLVLPELGALQVQLTVGDRDDDGRRTVQLYSRPYRDGSDEILAD
VAWTCHATGLLGPQPADAAPAFDLGVWPPPGATRVESDDFYSGIEATVFGYGPAFRGLRA
AWTRDDEVFAEVELPADHHATAGRFGVHPALLDGALQAMSIGGFLGRMGDGADASVPRLP
FAWTGVSLLAAGATALRVRVAAAGEVGVSFQVADATGAPVLHVDSLIMRRVSGDSLGAAR
SGRHESLFQVDWPVLPVPTGPVPAATRWVALGDDLALSAACEAAGARVRTDVGLDSLGDL
LAGGEPTPEAVIVPVGDAGDPTDPELAAQARATTHRTLAALRTWLADDRFADSRLVLVTR
NAVAAGEQKPVNLRQAPVWGLLRTAQLEHPGRCQLVDLDDAPDSAAAVAAAIASGEPQLA
VRDGQVRTPRLGRVPAAVEPLPGGIDPAGTVLITGGTGVLGRILARHLATSHGVRHLLLA
GRRGAAAEGIGDLVTELAGTGTEVAVVACDAADPEALSALLAGVPAAHPLTAVVHAAGVL
DDGVLESMTPDRVDAVAVPKIDAAWHLHRLTADANLAAFVLFSSAAATLGSAGQSNYAAS
NAFLDALAAHRRARGLAGNSLAWGLWEQASGMTGHLGDDDVRRMAEQGAVGLATEQALNL
FDAAWRLDAAAVLPMRLDVGTLRGQAEGGTLAPILRALVRVPLRRSVDATGARSGGVQLG
QRLAGLAAPERLKVVLDVVRANIAAVLGHAGPDAVDPNRLFTDLGFDSLTAVDLRNRLNN
LSGLRLPATLVFDYPTPTALAEKLTSEIAADAAPSTQPLFQGIDTVESLLTAIPLDPAAR
ARFTARMQDLLAKASDLAAGPSVEPDRPDLDSASDDEIFDFISKEFGIS
NT seq 10950 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaggcgaagcttctcgactacctcaagcgggtcaccgctgacctgcaccag
gtgcgccagcgcctgcgcgaggtggaagccggtgaacaggaaccggtcgccatcgtctcc
atgagctgccgcttcccgggcggggtgcgctcgcccgaggacctgtgggaggtggtcgcg
tccggccgggacgtggtctccgacttcccgaccgaccgcggctgggacgtcgggtcgctc
tacgacagcgaccccgagcaggccggtacgtcgtacacgcggcagggtggcttcgtccac
gacctggccgacttcgacccgggcttcttcgcgatctccccccgggaggcgctggcgatg
gacccgcagcagcgctggctgctggagacctcgtgggaggcactggagcgggccggcatc
gacccgcactcgctgcgcggcagccgcactggcgtcttcgccggcagcaccggccaggac
tacggcaccgtgctgatgggtgccgcgcagggcctcgaggggcacctgatgaccggcaac
gccggcagcgtggtctccggccggatcgcgtacaccttcgggttggaggggccggccgtc
accatcgacaccgcctgctcgtcctccctggtcgccctgcacctcgcgggccaggcgctg
cggcagcaggagtgcaccctggccatcgtcgccggcgtcaccgccatgtgcaccccggcc
gccttcgtcgagttctcccggcagcgcggcctcgccgccgacggccggtgcaaggcgttc
gccgccgccgccgacgggaccggctggtccgagggcgtcggcgtcctggtgctggaacgg
ctctcggacgcgcagcgcaacggtcaccccatcctcgccgtggtacggggcagcgcggtg
aaccaggacggcgcctccaacgggctgagcgccccgaacggaccgtcgcagcagcgggtg
atccagcaggccctggccaacgccggcctcgccgccggcggcgtggacgtggtggaggcg
cacggcaccggcacccgtctcggcgacccgatcgaggcgcaggcgctgctggccacgtac
ggacaggagcggggggactccgcgccgctgctgctcggctcggtcaagtcgaacatcggc
catgcgcaggcggccgccggggtggccggcgtcatcaagatggtcatggcgatgcggcac
ggcgtcgtaccgcccaccctgcacgtcgacgagccgacgcccgaggtcgactggtcggcc
ggcgacgtctcgctggtgaccgaggcgacgccgtggccggcggtggaccggccgcgccgc
tcggcggtctcctcgttcggggtgtccggcaccaacgcgcacaccatcctggagcaggcc
ccggcaccgcagccggccccgtcggccaccgcgccggtggtcgagcggccggtcgtaccg
gtgccggtgtcggcccgggacgctgccggcctcgccgcgcaggcggcccgctgggcggcc
cggatcgccgccgacgagaccctgcgccccctggatgtggccttctcgtcggtcacctcc
cggtccaccctggaccaccgcgccgtggtccacgcgaccggccgcgaggacctgctggcc
gggctgcgcgccctcgccgccggtcagccgtccggcgcggtcgtcgccgggcaggccggc
ggccggggctcgctcgcggtgctcttctccggccagggcgcgcagcgcgccggcatgggc
cgggagctgtacgtgggcttcccggtgttcgccgccacgctggacgaggtgtgcgtgtac
ctggacgcgctgctgccgcgtccgctgcgggaggtgctgttcgcgctggagggttccgcc
gaggcggctctgctggaccagacggtgttcacgcaggcgggcctgttcgccgtcgaggtg
gcgctgttccgcctcgtcgagtcgctcggcatcgcgccggagttcgtgggcggtcactcg
atcggtgaggtgacggccgcgtacgtggcgggggtgctgtcgctggccgacgcgtgtgcg
ctggtggcggcgcggggccggctgatgcaggccctgccggccggtggcggcatgctcgcg
gtggccgccgacgaggtggcggtggtcgagtcgatcgccggctcgaccgaccgggtcggg
atcgcggccgtcaacgggccgacctcggtcgtggtctccggtgccgtcgacgccctcgac
gaggtggagcgggtctggcgtgagcggggcgtgcgtacgcgccggctgaccgtcagccac
gcgttccacagtccgctgatggagccgatgctcgccgagttccgcgccgtcctcgacggg
ttgacgttctccgcgccgtcgctgccggtggtgtcgaacgtgaccggtgcgctggccgac
gccgacgagatccgtacggccgactactgggtgcgccacgtccgcgaggccgtccgcttc
gccgacggggtcaccgcgctgcgcgccgccggggcggacacgttcctggaggtcgggccg
cgcagcgtcctgaccgcgatggtcggcgagatcctgcccgccgacgacgccgtgctggcc
gtcgccgcgcagcgcaaggaccggcccgaggtgcacgggctgctggccgggctggcggag
ctgcacgtgcacggggttgcggtcgactggcggcagtggttcgccgagaccggcgcccgg
cgggtggacctgcccacgtacgccttccagcaccagcgctactggcccgaggcgggcgcc
gggtggaccggcgacgtcaccgcggtcggcctgcgccccgcgcaacaccccctgctcgga
gccgccgtcggcgtcgcgcacgccgagggcttcctcttcaccggccggctggcccggcgt
acccacccgtggatctgcgaccacgtcgtcttcgacaccgtgctgctgccgggcacgggt
ttcgtcgaactcgccctccaggcgggtgggcacgtcggcgcggaccacgtccgcgaactg
accctggagtcgccgctgatcctgccggagaccgggggcgtggacatccagctctggatc
ggcccggcggacgagaccgggtgccgttccgtgtcgctgcactccgcgcaggacggcgag
ccgaccgagggcacgggtgagcgggcctggacccgcaacgccagcggcgtgctggccagc
ggcccggccgtgccgagcggtcccgccggctggtccgacctgaccacctggccgccgccg
ggcgcgaccgaggtcggcaccgacgacctctacctgaacctcgccgcccagggttacgac
tacggcccgtcgttcatcgccctgcgctccgcctggcggcgcggcgacgacctcttcgcc
gagctggcgctgcccgaggcccccgccgccgaggccgccgggtacggcctgcacccggcc
ctgctcgacgcggcgctgcacaccctcggcctgaccacgccggccggggagccctccggg
gcgggcatgccccccggattcggccgcctgccgttctcctggaacgacgtcgccctgcac
ggcgccggggccgcggcggcccgcgtccgggtctcgcacaccggccccgacagcatctcg
ctgctgctcaccgacgtcaccggcgcgccggtcatctccgtcggctccctcgtcctgcgg
ccggtctccgccgaccagctccgcaccgcctccggcggcggcaccgagtcgctgttccgg
gtcgagtgggccccgctcgcgcttcccgccggcccgtccacggtcgactgggcggtgctc
ggcgacgccgcggcgctcaccgacgcggtcgccgccaccggcacggccgtggcggcgtac
cccgacctggcggccctggccacggcgatggacggcgggacggacgcgcccggcgtgctg
gtcctgccgttgctcgacccgcccgcgtcggcggacgtgccgcgcgccgtcgccgaggcg
acccaccgggtgctcgccgtgctccagcagttcctcgccgaggagcgctacgcggtgtcc
cgactggtggtgctgacctcgggcgcggtcgccaccgaccgggacaccgacctgacggac
ctggccggcgccgccgtgatcggcctgctgcgctccgcccagtcggagaaccccgaccgg
ttcgtgctggtggacgtcgacgacgtggccggctgcgccgccgcgctcgtcccggccgtc
gcgaccgacgagccgcaggtcgtgatccgcgcgggcgtcgccgccggcgcccggctcacc
cggggcgccgccccgaccgaaccgccggcagccccgttcgactccgacggcaccgtcctg
atcaccggcgccaccggcaccctcggccggctgatgagccggcacctggtcagcacgtac
ggcgtccggcgcctgatcctcaccagccggcgcggccgcgccgccgagggtgtcgcggag
ctctgcgccgagttggaggcgctcggcgtgcgcgtcaccgtcgccgcctgcgacgtcgcc
gaccgtggcgccgtggccgagctgctggccggcatcccggcggagcacccgctgaccgca
gtcatccacgccgccggcgtccgtgacgacggcgtcatctcctcgctcacccccgagcgg
atggacggcgtgctgcggcccaaggtcgacgccgcctggcacctgcacgagctgaccgcc
gacctcgaactgaaggcgttcgtctcgtactcctcgctggccgccaccgccggtggcccg
ggccagggcaactacgccgccgccaacgcgttcctcgacgggctggcccagcaccgcaag
gcgcgcggcctcgccgccctcaccctcgcctggggcctctgggccgaccgcagcggcatg
accaccgagctggacgacgtccacctcaaccggatctcccgctccggcgtcgccgccatg
gaggccgaggaggggctcgccctcttcgacgcggcctgccgcaccaccgacgccgcgctc
gtcccggcccggctggatctcgccgcgatgaaggtgcagttcgccggcgggaccatcccg
ccgctgtaccgggcgctgatccgcacgcccgcccgcgccgccgcggccagcaccggcgcg
tcgctggtgcagcagctcgccgggctcggcgacgccgagcgggccgccgcgctggtcgag
atcgtccggggccaggccgccgccgtgctcggctaccccgacccggcggccatcgagccg
cgccgggcgttcagcgagttcggcttcgactcgctcaccgccgtcgagatgcgcaaccgg
ctcaacaacgccttcgggatgcggctgccggccaccctcgtcttcgactacccgaccccg
cacgacctggcggccttcctgggtacggagatcgccggcaccccggttcccgtgcgaccc
acgacgaccgccgtgtcggtcggcgacgacgagcccctcgcgatcatcggcatggcctgc
cggctgcccggcggcgtgtggtcgcccgacgacctgtggcggctggtggtcgacggcgtg
gacgcgatcagcgacctgcccaccgaccgtggctgggacctcgacagcctctacagcccc
gaccccgacgcccccggcaccttctacgcccgcggcggcggcttcctcagcggcgtcgac
aggttcgaccccaacttcttcggcatctcgccccgcgaggccctggccatggacccgcag
cagcgactgctgctggagaccacctgggagtccttcgagtccgccggcatcgaccccacc
gacgtacggggcagcagcaccggcgtcttcgtcggcaccagcggccaggactacggctcg
ctgctcgcgtactcgccggaggccgccgagggctacatgctgaccgggatgaccagcagc
gtcatctccggccgggtcgcctacacgttcgggctggaggggccggcggtgtcgctggac
acggcctgctcgtcgtcgctggtggcgctgcactgggccggccaggcgctgcggcgcggc
gagtgcgacatggccctcgccggcggtgtcatggtgatggccaccccgaccgccttcgtc
gagttctcccggcagcgcggcctggccgccgacggccggtgcaagtcgttcgccgcgtcc
gccgacggcaccggctggtccgagggcgtcggcatgctgctcgtgcagcggctctccgac
gcccgccggcagggccgcaccgtctacgcggtggtgcgcggctcggcgatcaactccgac
ggcgcctccaacgggctgaccgccccgaacggcccctcgcagcagcgggtgatccggcag
gcgctggcgtcggcccgcctcaccacggccgacgtcgacgtggtcgaggcgcacggcacg
ggcaccaccctcggcgacccgatcgaggcgcaggccctgctcgccacgtacgggcgggag
cggcccgccgaccggcccctgctgctcggctcgatcaagtcgaacatcggccacgcccag
gccgccgccggtgtggccggcgtgatcaagatggtgcaggccatccggcacggcctcgtc
ccggcgacgctgcacgtggacgagccgtccccgcacatcgactggacctccggtgcggtg
gagctggcgacgcagtcgcggccctggccggcggtggaccggccgcgccgggcggcggtg
tcgtcgttcggcatctccggcaccaacgcccacgtcatcatcgagcaggccgacgaactg
tccgtggcaccggccgagcccggccccgggctcgtggcctccgacgcggtgctgtggccg
ctgtcgggacggtcgaagggcgccctggccggccaggcggcccgtctcgcggagtacgtg
cgtgagcgcggcgacatcgacgcggcggcggtgggctggtccctggctacgacccggtcg
gcgttcggtcaccgtgccgctgtcgtcgggtcgggcacggaggagttgctggcggggctg
gacgcggtggcgtccgggacgccggccggcaacgtcgtcgccgacaccaccacgtcccac
ggcgcgggcccggtgttcgtgttcccgggccagggcgcgcagtcggcgcggatggctgcc
ggtctcgtcggtcgtacgccagtgttcgacgcgcgtctggcggagtgtcagcgggccctg
gccccgtacctcgatgtcgatctcgtgtcggtgttgaccggcgaggacgagtcgtggctg
gagcgggtcgaggtggtgcagccggtgctgtgggccgtcggtgtggctctggcggcggtg
tggcagtacgccggggtcaccccggctgcggtgatcggtcattcgcagggtgagatcggg
gccgcgtgtgtggccgggatcctcagcatcgaggatgcggcgaaggccgtggccctgcgg
tcgcgggcgctgacggtgctgcggggcaccggcacgatggcgtcggtcgacctgtcggcg
gagtcggtggccgagcggctgccggcgttcccgggcgtcggtgtcgcggcggtcaacggc
ccgtccaccgtcgtggtctcgggtccgccgcagccggtcgccgacctcgtggaggcgtgc
caggccgacggcgttcgggcccgcttgatcccggtcgactacgcgtcgcattcggcggcc
gtgcaggacgtcgccgagcagttgcgcgccgacctggccgacgtgacgccgcagccgggc
cacacccgcctcgtgtcgacgctcaccggggactgggtggacccggcgtcgatgacggcg
gactactggtatgagaacctgcggcagacggtgcagttcgacgcggcggtgcgggtggct
gtcgccgccgggcacaccacgttcgtggagatctctccgcacccggtgttggcgatgccg
gtcacggcgatcctggacgacgccggcgtgagcgggcacacgctgggcagtctgcgccgc
ggtgacgacgacgcgacgcggctgctgacgaacctcgccaccgcgcacacgatcggtctg
cccgtcgacctgacggccgtactcgccgagaccgacaccgtcgcactgcccacgtacgcc
ttcgaccaccagcggtactgggtcgagccgccggtgcaccgggcgcaggacgtcgcctcc
gccggcctccaggacgccgggcacccgctgctcagcgccgcgctgaccttccccgacagc
gagcggatggtcttcaccgggcggctgtcggtgcgtacccacccgtggctcggcgagcac
cgggtgatggacaacatcctgctgcccggcaccgccttcgtcgaactggccacgtacgcc
ggtgagcaggccggctgcccgacggtggaggagctgaccctgctcgccccgctcgtcctg
cccgaactcggcgcgctccaggtgcagctgacggtcggcgaccgggacgacgacgggcgg
cgtaccgtccagctctactcccggccctaccgggacggctcggacgagatcctcgccgac
gtcgcctggacctgccacgccaccggtctgctcggcccgcagccggccgacgccgcgccc
gccttcgacctaggggtctggccgccgcccggcgcgacacgcgtcgagtccgacgacttc
tactccggtatcgaggcgaccgtcttcggctacggaccggcgttccgtggcctgcgcgcc
gcgtggacccgcgacgacgaggtcttcgccgaggtcgagctgcccgccgaccaccacgcc
acggccggccgcttcggcgtgcacccggcactgctggacggcgcgctgcaggccatgtcg
atcggcggcttcctcggccggatgggcgacggcgccgacgccagcgtgccccgtctgccg
ttcgcctggaccggggtctccctgctcgccgccggggccaccgccctgcgcgtacgcgtc
gccgcggccggcgaggtcggcgtctccttccaggtggccgacgccaccggcgccccggtg
ctgcacgtcgactcgctgatcatgcgccgcgtctccggggactccctcggcgcggcccgc
tccggccggcacgagtcgctgttccaggtggactggccggtgctgccggtgccaaccggc
cccgtgccggcggccacccgctgggtggcgctcggcgacgacctggcgctcagcgccgcc
tgcgaggcggccggtgcccgggtgcgtaccgacgtcgggctcgactcgctgggcgacctg
ctcgccgggggtgagccgacgcccgaggcggtgatcgtcccggtcggcgacgccggggac
ccgacggacccggagcttgccgcacaggcgcgggccaccacgcaccgtacgctcgccgcg
ttgcggacctggctcgccgacgaccggttcgccgactcgcggctggtgctcgtcacccgg
aacgcggtcgcggcaggggagcaaaagccggtgaacctgcgccaggcccccgtctggggc
ctgctgcgcaccgcccagctcgaacacccgggccggtgccagctcgtcgacctcgacgac
gccccggacagcgccgccgcggtggccgccgccatcgcctccggcgagccgcagctcgcc
gtgcgcgacgggcaggtccgcacgccacggctcggccgggttccggccgccgtcgagccg
ctgcccggcgggatcgacccggccggcaccgtgctgatcaccggcggcaccggcgtgctg
ggccgcatcctggcccgccacctcgccaccagccacggcgtacggcacctgctgctggcc
gggcggcgcggcgcggcggccgaggggatcggcgacctggtcaccgaactcgccggcacc
ggtacggaggtggccgtcgtggcctgcgacgccgccgaccccgaggccctgtcggcgctg
ctggccggggtgcctgcggcgcacccgctcaccgccgtggtgcacgccgccggcgtcctc
gacgacggcgtgctggagtcgatgacccccgaccgggtggacgcggtcgccgtgccgaag
atcgacgccgcctggcacctgcaccgcctcacggccgacgcgaacctcgcggccttcgtc
ctgttctcctcggcggcggccacgctgggcagcgccggccagtccaactacgcggcgtcg
aacgccttcctcgacgccctcgcggcgcaccgccgggcacgtgggctcgccggcaactcg
ctcgcctggggcctgtgggagcaggccagcggcatgacgggtcacctcggcgacgacgac
gtgcgacggatggccgagcagggcgccgtcggcctggccaccgagcaggcgctgaatctc
ttcgacgccgcgtggcggctcgacgcggcggccgtcctgccgatgcgcctggacgtcggg
acgctgcgcgggcaggcggagggcggcaccctcgcgcccatcctccgggccctggtccgg
gtgccgctgcggcgctccgtggacgccaccggtgcccgctccggcggggtccaactcggc
cagcggctcgccggactggccgccccggagcggctcaaggtggtgctcgacgtggtacgg
gcgaacatcgccgccgtcctcggccacgccggccctgacgcggtcgacccgaaccggctc
ttcaccgacctgggcttcgactcactcaccgccgtcgacctgcgcaaccggctcaacaac
ctgtccggcctgcggctgccggcgacgctcgtcttcgactacccgacgccgacggcgctc
gccgagaagctgacaagcgagatcgccgccgacgcggcgccctccacccaaccgctcttc
cagggcatcgacacggtggagagcctgctcaccgccatcccgctcgacccggcggcccgc
gcccggttcaccgcccggatgcaggacctgctcgccaaggcgtccgaccttgcggccggg
ccctccgtcgaaccggaccggccagacctcgactcggccagcgacgacgagatcttcgac
ttcatcagcaaagagtttggaatctcctga

DBGET integrated database retrieval system