KEGG   Microbacterium sp. CGR1: AKG07_06770Help
Entry
AKG07_06770       CDS       T04046                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mim  Microbacterium sp. CGR1
Pathway
mim03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mim00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AKG07_06770
Enzymes [BR:mim01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AKG07_06770
DNA repair and recombination proteins [BR:mim03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AKG07_06770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AKV87973
LinkDB All DBs
Position
1401845..1403821
Genome map
AA seq 658 aa AA seqDB search
MVAEAQNVQIDGRRLRITNLDKVVYPETGTTKGEIIAYYTAIAPHLLPLLAGRPVTRKRW
VEGVGTADAPADAFFTKQLEPGAPEWIPRQPIRHSDGPKEYPLVQDVPTLVWLAQVAAIE
LHVPQWRFASDGMPGKPDRLVLDLDPGPGVGLAQCAEVARIARSLLSDIGLDPVPVTSGS
KGIHLYAALPGQQTSAEISAVAKEIARLIETGHPDLATSTMAKAARGGKVFLDWSQNNGK
KTTISPYSMRGRAHPWVAAPRTWDELDDPDLAQLDFATVLERAGSGQDPIAPLLAAQEGP
PDTTSAPGPRVDAHGANSHASRHRPRTTGAAPLASSSPPSISPMLAENGTPAIARTLSSP
SWVEVKWDGIRAIGTWADGRMLLHARSGTDITARYPELTADGAPFLPVSDAIIDGEIVAF
DAQGRPSFSMLQNRMHLTRPREIEREVVRTPIVYMAFDLLRLNGHDLSSMALSERRTLLE
EVVADLDAPVQVPPVFDDLDAALAASDEFGLEGVVVKDPSSRYRPGQRSPAWLKIKHTRM
QEVVIVGIRPGKGDREGTFGSLLLAVPESGRLRYVGRVGTGFTDRMLRDLLSRLAPLRTD
SAPLEDVPALDASDALWVRPELVGEVEFANWTPDGVLRHSRWRGLRPDKTPDEVIVES
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcagaggcgcagaacgtgcagatcgatggccgccggctgcgcatcaccaacctc
gacaaggtcgtctaccccgagaccggcaccacgaagggcgagatcatcgcctactacacg
gcgatcgcgccgcacctcctccctctgctcgcgggccgccccgtgacccgcaagcgctgg
gtggaaggggtggggaccgcggatgctcccgccgacgcgttcttcacgaagcagctcgag
ccgggagctccggaatggatcccccgacagccgatccggcactcggacggccccaaggag
tatcccctcgtccaggacgttcccacgctggtctggctcgcgcaggtcgccgcgatcgag
ctgcacgtgccgcagtggcgcttcgcctccgacggcatgccgggaaagccggatcggctc
gtcctggatctcgacccgggcccgggggtcgggctcgcccagtgcgccgaggtcgcacgg
atcgcacgcagcctgctcagcgacatcggactcgatccggtgcccgtgaccagcggaagc
aaagggatccacctctacgccgccctccccgggcagcagacgagcgcagagatatccgcg
gtcgcgaaggagatcgcccgtctgatcgagaccgggcatccggatctcgccacgagcacg
atggccaaggccgcgcgcggcggcaaggtctttctcgactggagccagaacaacggcaag
aagacgacgatctcgccgtactcgatgcgtggtcgcgcgcacccctgggtggcggctccg
cgcacctgggacgaactcgacgaccccgacctcgcgcagctcgacttcgcgacggtgctc
gagcgtgcgggttccgggcaggaccccatcgctccgcttctcgccgcccaggagggcccc
ccggacaccacctctgcgccgggcccccgcgtcgacgcacacggcgcgaactcgcatgcg
agccgccaccgcccgcggacgaccggtgcggcaccgctggcctcgtcgtctcccccctcc
atctcccccatgctggccgagaacggcacgccggcgatcgcccgcactctgagctctccg
tcgtgggtggaggtgaagtgggacggcatcagggccatcggaacctgggcggacggacgg
atgctgctgcatgcccgcagcggcaccgacatcacggcccgctaccccgagctgactgcc
gacggcgcgccgttcctgcccgtgtccgatgcgatcatcgatggcgagatcgtcgccttc
gatgcgcagggcaggccgagcttctcgatgctgcagaaccgcatgcacctgactcggccc
cgcgagatcgaacgcgaggtcgtgcgcacgcccatcgtctacatggctttcgatctgctc
cgcctgaacggtcacgacctcagctccatggcgctgtcggagcgacggaccctcctcgag
gaggtcgtcgccgacctcgatgcgccggtgcaggtcccacccgtgttcgacgatctcgac
gccgctctcgcggcgagcgatgagttcggcctcgagggcgtcgtcgtcaaggatccgtcc
tcgcggtaccgtccgggccagcgctcaccggcctggctgaagatcaagcacacccgcatg
caggaggtcgtgatcgtcggtatccgccccggcaagggcgaccgggagggcacgttcggc
tccctgctgctcgcggtccccgagtccggacggctgcgctatgtcggtcgcgtcggcacg
ggattcaccgaccggatgctgcgcgacctgctgagccggctcgctcccctgcgcaccgac
tccgcgcccctcgaggacgtgcccgcgctcgatgcgtcggatgcgctctgggtccgacct
gagctcgtcggcgaggtcgagttcgcgaactggaccccggacggcgttctgcgtcactcc
cgttggcggggactccggccggataagactcccgacgaggtgatcgtcgagtcctga

DBGET integrated database retrieval system