KEGG   Microbacterium sp. CGR1: AKG07_08375Help
Entry
AKG07_08375       CDS       T04046                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mim  Microbacterium sp. CGR1
Pathway
mim00250  Alanine, aspartate and glutamate metabolism
mim00280  Valine, leucine and isoleucine degradation
mim00310  Lysine degradation
mim00410  beta-Alanine metabolism
mim00640  Propanoate metabolism
mim00650  Butanoate metabolism
mim01100  Metabolic pathways
mim01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AKG07_08375
   00650 Butanoate metabolism
    AKG07_08375
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AKG07_08375
   00280 Valine, leucine and isoleucine degradation
    AKG07_08375
   00310 Lysine degradation
    AKG07_08375
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AKG07_08375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mim01007]
    AKG07_08375
Enzymes [BR:mim01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AKG07_08375
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AKG07_08375
    2.6.1.48  5-aminovalerate transaminase
     AKG07_08375
Amino acid related enzymes [BR:mim01007]
 Aminotransferase (transaminase)
  Class III
   AKG07_08375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AKV86307
LinkDB All DBs
Position
complement(1726718..1728085)
Genome map
AA seq 455 aa AA seqDB search
MALLDTAAVAVPLGGPDLPQERRLVTDLPGPRSAEILARKADAVAAGVGHTVPVAAVAAG
GGVVVDADGNSLIDLGSGIAVTTVGNAHPKIAAAVAAQAAQFTHTCFMISPYESYIGVAE
ALNRLTPGDFAKKSALFNSGAEAVENAIKIARKHTGRQAVVAFDHGYHGRTNLTMALTAK
SMPYKSGFGPFAPEVYRAPMSYPFRDGLDGAEAAARVILQLEKQIGADNLAAVIIEPIQG
EGGFIVPAEGFLPAIASWSRANGVVFIADEVQTGFARTGHMFASEIFGIEPDLITTAKGI
AGGLPLAAVTGRSEIMDASHAGGLGGTYGGNPIACAAALAAIDVFENDGVIERAREIGEI
LTARLGAMQEKDTRIGDIRGHGAMIAAEFVDPETNAPDAALTSAVAKACVAQGVIVLTCG
TYGNVIRFLPPLSIGDDLLNEGLDVVAAALAATAG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggctctcctcgacaccgcagctgttgcagtcccgctcggcggacccgacctcccccag
gagcgtcgtctcgtcaccgaccttcccggcccccgctcggccgagatcctcgcccgcaag
gccgatgccgtcgccgccggcgtcgggcacacggttcccgtcgcggccgtcgccgccggc
gggggagtggtcgtggatgccgacggcaactcgctgatcgacctcggctccggcatcgct
gtgacgaccgtcggcaacgcgcaccccaagatcgccgcagccgtggccgcgcaggccgcg
cagttcacgcacacctgcttcatgatctcgccgtacgagtcgtacatcggtgtcgccgaa
gcgctcaaccgcctcactcccggcgacttcgccaagaagagcgccctgttcaactccggc
gccgaggccgtcgagaacgcgatcaagatcgcccgtaagcacaccggtcgccaggccgtc
gtcgccttcgaccacggctaccacggccgcaccaacctcaccatggcgctgaccgcgaag
tcgatgccgtacaagagcggcttcggcccgttcgcccctgaggtgtaccgtgcgccgatg
tcgtacccgttccgcgacggtctcgacggcgcagaggccgccgcccgcgtgatcctgcag
ctcgagaagcagatcggcgccgacaacctcgccgccgtcatcatcgagccgatccaggga
gagggcggcttcatcgtcccggcggagggcttcctcccggcgatcgcctcgtggtcccgc
gcgaacggcgtcgtgttcatcgccgacgaggtgcagaccggcttcgcccgcaccggccac
atgttcgcgagcgagatcttcggcatcgagcccgacctcatcacgaccgccaagggcatc
gcgggcggtctgcccctcgccgccgtcacggggcgctccgagatcatggacgcctcgcac
gcaggcggcctcggcggcacctacggcggaaacccgatcgcctgcgctgcggcgctcgcc
gcgatcgatgtgttcgagaacgacggcgtgatcgagcgcgctcgcgagatcggcgagatc
ctgacggcacgcctcggagccatgcaggagaaggacacccgcatcggagacatccgcggc
cacggcgccatgatcgccgccgagttcgtcgaccccgagaccaacgcgcccgacgccgcc
ctcacctccgcggtcgccaaggcctgcgtcgcgcagggcgtcatcgtcctgacgtgcggc
acctacggcaacgtcatccggttcctcccgccgctctcgatcggcgacgacctcctgaac
gagggcctcgacgtcgtcgcggccgcgctcgccgccaccgcgggctga

DBGET integrated database retrieval system