KEGG   Microbacterium sp. CGR1: AKG07_10515
Entry
AKG07_10515       CDS       T04046                                 

Gene name
rocD
Definition
(GenBank) ornithine--oxo-acid aminotransferase
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
mim  Microbacterium sp. CGR1
Pathway
mim00330  Arginine and proline metabolism
mim01100  Metabolic pathways
mim01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mim00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AKG07_10515 (rocD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mim01007]
    AKG07_10515 (rocD)
Enzymes [BR:mim01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     AKG07_10515 (rocD)
Amino acid related enzymes [BR:mim01007]
 Aminotransferase (transaminase)
  Class III
   AKG07_10515 (rocD)
SSDB
Motif
Pfam: Aminotran_3 DegT_DnrJ_EryC1 Aminotran_1_2
Other DBs
NCBI-ProteinID: AKV86655
LinkDB
Position
complement(2164689..2165900)
AA seq 403 aa
MTAVDSGVSAEVTAEPHVAHNYHPLPVNIARGEGAWVTDVEGKRYLDLLAAYSAVNFGHR
HPALVAALTEQLGRVTLTSRAFMSDRLEPFAAALSTLAGKDMVLPMNTGAEAVETGIKVA
RAWGYRVKGIADDQARIIVAAGNFHGRTTTIVSFSDDPEARTDFGPYTPGFDVVPYGDAD
AVAAAITENTAAVLIEPIQGEGGVVIPPEGYLRRIREICDEKNVLFIADEIQSGLGRVGE
TFACDREGVVPDLYLLGKALGGGILPVSAVVGDADVLGVIRPGEHGSTFGGNPLAAAVGL
RVVEMLESGEFQERARALGAHLAAGLEPLIGHGVTEVRIAGLWAGVDIDPAKGTGREIAE
KLLDRGVLVKDTHGQTIRIAPPLVIRATELDWAVEQLKLVLGA
NT seq 1212 nt   +upstreamnt  +downstreamnt
gtgaccgccgtcgactcgggcgtgagcgccgaggtgacggcggagccgcacgtcgcccac
aactaccacccgctgccggtcaacatcgcccggggtgagggtgcgtgggtgacggatgtc
gagggcaagcggtacctcgatctgctcgccgcctattcggcggtgaacttcgggcaccgg
catccggctctcgtggcggccctgaccgagcagctcggtcgcgtcaccctcacgagccgc
gccttcatgagcgatcggctcgagccgttcgccgccgcgctgtcgactctcgccggcaaa
gacatggtgctgccgatgaacaccggcgccgaagcggtcgagaccggcatcaaggtcgct
cgcgcatgggggtatcgcgtcaagggcatcgcggacgaccaggcgcgcatcatcgtcgcg
gccggcaacttccacggccgcaccacgaccatcgtcagcttcagcgacgaccccgaggcg
cggacggacttcggcccgtacacgccgggattcgacgtggttccctatggggacgcggat
gccgtcgcagcggccatcaccgagaacaccgccgccgtgctgatcgagccgatccagggc
gagggcggagtggtgatccccccggagggatacctgcgccgcatccgcgagatctgcgac
gagaagaacgtgctgttcatcgccgatgagatccagtcgggtctcggccgggtcggcgag
accttcgcctgcgatcgggagggcgtcgtgcccgacctgtatctcctgggcaaggcgctg
ggcggcgggatccttccggtgtcggcggtcgtcggcgacgcggatgtgctcggagtcatc
cgcccgggtgaacacggttcgacgttcgggggcaacccgctcgccgcggccgtcggcctg
cgggtcgtcgagatgctcgagtccggggagttccaggagcgcgctcgcgcactcggcgcc
cacctcgccgccggcctcgagccgctgatcgggcacggggtgaccgaggtgcgcatcgcc
gggctgtgggccggcgtcgacatcgaccccgccaaggggaccggccgcgagatcgcggag
aagctcctcgaccggggtgtgctcgtcaaggacacccacggtcagacgatccgcatcgcc
cctccgctggtgatccgcgcgaccgaactcgactgggcggtcgagcagctgaagctggtt
ctcggggcgtga

DBGET integrated database retrieval system