KEGG   Microbacterium sp. CGR1: AKG07_11085
Entry
AKG07_11085       CDS       T04046                                 

Definition
(GenBank) hypothetical protein
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
mim  Microbacterium sp. CGR1
Pathway
mim00860  Porphyrin and chlorophyll metabolism
mim01100  Metabolic pathways
mim01110  Biosynthesis of secondary metabolites
mim01120  Microbial metabolism in diverse environments
mim01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mim00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AKG07_11085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mim01007]
    AKG07_11085
Enzymes [BR:mim01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     AKG07_11085
Amino acid related enzymes [BR:mim01007]
 Aminotransferase (transaminase)
  Class III
   AKG07_11085
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Other DBs
NCBI-ProteinID: AKV86750
LinkDB
Position
complement(2293485..2294813)
AA seq 442 aa
MTDRNDDLFSAARTVIPGGVNSPVRAYGSVGGTPRFLASASGATVTDAAGNRYVDLVASW
GPALLGHAQPDVVAAVQEAATRGLSFGAPTEGEVELAQLIADRVRFGEVRPVERVRLVST
GTEATMTAIRLARGATGRDLLVKFAGHYHGHSDGLLAAAGSGVATLALPGSAGVPAPIAA
QTLVIDYNDPDALAAVFAEHGPRIAAVIVEAAAANMGVVPPLPGFNRLLAETAHAHGALL
ILDEVLTGFRVHPAGFWGLQAAAGEDYLPDIITFGKVVGGGMPLAALGGRAEIMDLLAPL
GPVYQAGTLSGNPLSVAAGLATLRLATPEMYATVDAAAARVSRALDEALTEAGATHAVAH
AGNLFSASFRGSAPRDYTEAQAQESFRYAPFFHAMREQGVALPPSVFEAWFLTAAHGEEE
LQRIEAALPVAARAAADAAATA
NT seq 1329 nt   +upstreamnt  +downstreamnt
gtgaccgaccgcaatgacgacctgttctccgctgcccgcacggtgatccccggaggggtg
aactcgccggtgcgcgcgtacggctcggtcggcggcacgccgcgcttcctcgcctcggcg
agcggcgcgacggtgacggatgccgcaggcaaccgctacgtcgacctcgtggcatcctgg
gggccggcgctgctcggccacgcgcagccggatgtggtcgccgccgtgcaggaagcggcc
acccgaggcctctcgttcggcgctcccacggagggcgaagtcgagctcgctcagctgatc
gccgaccgcgtgcggttcggggaggttcggccggtggagcgggtgcggctcgtgtcgacc
ggaaccgaagcgaccatgacggcgatccgcctcgcccgcggcgccaccggacgcgacctg
ctggtgaagttcgccgggcactatcacgggcactccgacggtctgctcgccgcggcgggc
tccggtgtcgcgacgctcgcgcttccgggttccgcgggtgtgcctgcgcccatcgcggct
cagacgctggtgatcgactacaacgatcccgacgctctcgcagctgtgttcgccgagcac
ggcccgcgcatcgcagcggtgatcgtcgaggccgcagcggcgaacatgggcgtcgttccg
ccgctgccggggttcaaccgcctgctcgccgagaccgctcacgcccatggcgccctgctg
atcctcgacgaggtgctgacgggcttccgcgtgcacccggcgggcttctgggggctccag
gcggccgccggtgaggactatctgcccgacatcatcaccttcggcaaggtcgtcggcgga
gggatgccgctggctgcgctcggaggccgtgcggagatcatggaccttctcgctcctctg
ggacccgtctaccaggcgggcacgctgtcgggtaacccgctgtctgtcgccgcgggtctc
gcgacgctgcgcctcgccacgccggagatgtacgcgaccgtcgacgcggccgcagcgcga
gtctcccgcgccctggatgaggcgctcacggaggccggtgcgacccacgccgtcgcccat
gccggcaacctcttcagcgcctccttccgcggatctgcacctcgcgactacaccgaggct
caggcgcaggagtcgttccggtacgccccgttcttccatgcgatgcgcgagcagggcgtg
gcgctccctccgagcgtgttcgaggcgtggttcctcaccgccgctcacggtgaggaagag
ctgcagcgcatcgaggcagctctgcccgtggctgcgcgcgccgcagctgatgccgctgcg
actgcctga

DBGET integrated database retrieval system