KEGG   Microbacterium sp. CGR1: AKG07_12800Help
Entry
AKG07_12800       CDS       T04046                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mim  Microbacterium sp. CGR1
Brite
KEGG Orthology (KO) [BR:mim00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mim01001]
    AKG07_12800
Enzymes [BR:mim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AKG07_12800
Protein kinases [BR:mim01001]
 Serine/threonine kinases: Other
  Bacterial family
   AKG07_12800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Haspin_kinase PASTA Kdo DUF3357 RIO1 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AKV87026
LinkDB All DBs
Position
complement(2634773..2636524)
Genome map
AA seq 583 aa AA seqDB search
MRPTQGVSFGGRYELQSRIAIGGMGEVWEATDHVIGRTVAIKILKDEYMGDPGFLERFRA
EARHAALVNHEGIASVFDYGEENGSAYLVMELVPGEALSTVLERDGALSADKTLDIVAQT
ASALQAAHAAGLVHRDIKPGNLLITPDGRVKITDFGIARIADQVPLTATGQVMGTVQYLS
PEQASGHPASPATDTYSLGIVAYECLAGKRPFTGESQVAIAMAQINEQPPPLPPTVPIPV
QNLVMAMIAKKPADRPSSSATVARAAQALRRGDLNSAAIAVPAIATGGVASDDATRLLTA
SGDDGTTRILPTTAQLPTGEQAEEEAEKKKKRSPWTWPLIALIALLVIVLGGTVFALMNQ
GDPDPEPTQSETVSQTPKPTPTETETPEPELVDVDALGLVGMQCDAAQTAAANAGLQAEC
VVGNTIAPNANQVGTVESVQPGGNVPEGTAITLTTFKEQVKVGKPSGTPTIAGTATEGEP
VTLNWPSFECPSGTPARSAFEVTLTNATFSGGNAGESIRSFGPSVLSTQIVPGTAGQSIT
ATFRVFCGSDMPSEQSDAMPGVVILPAAPGADEGDADGGDSGE
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgagaccgacgcagggtgtgtcgttcggtggtcgctacgagctgcagtcgcgtattgcg
atcggcggcatgggcgaggtgtgggaggcgacggatcacgtcatcggtcgcaccgtggcc
atcaagatcctcaaggacgagtacatgggggaccccgggttcctcgagcggttccgcgct
gaggcgcgccatgccgcactcgtcaaccacgagggcatcgcgagcgtcttcgactacggc
gaggagaacggcagcgcctacctcgtcatggagctcgttcccggcgaggccctctcgacc
gtgctcgagcgcgacggcgccctgagcgccgacaagaccctcgacatcgtcgcgcagacg
gcatccgctctgcaggccgcgcatgcggcaggtctcgtgcaccgtgacatcaagccggga
aacctgctgatcacgcctgacggccgcgtcaagatcacggacttcggcatcgcccgcatc
gccgaccaggtgccgctgacggccaccggccaggtcatgggcaccgtgcagtacctctcg
cccgagcaggcgtcggggcacccggcgtcaccggcgaccgacacgtactcgctcggcatc
gtcgcctacgagtgcctcgcaggcaagcggcccttcacgggtgagtcgcaggtcgcgatc
gcgatggcgcagatcaacgagcagcctccgccgctgccgccgaccgtgccgatcccggtg
cagaacctcgtcatggcgatgatcgccaagaagcccgccgaccgcccgtcgtcgtcggcg
accgtcgcacgcgccgcccaggctctgcgacgaggcgacctgaactccgctgccatcgcg
gtgccggccatcgcgaccggtggtgtcgcctccgacgacgccacccggctgctcaccgca
tcgggcgacgacggcacgacgcgcatcctccccacgacggcccagctgcccaccggcgag
caggccgaggaggaagccgagaagaagaagaagcgcagcccctggacgtggccgctgatc
gctctcatcgcactgctcgtgatcgtgctcggtggaaccgtgttcgccctgatgaatcag
ggcgacccggatcccgagccgacccagtcggagaccgtgtcgcagaccccgaagccgaca
ccgaccgagaccgagacgcccgagcccgagctcgtggacgtcgatgctctcggtctcgtg
gggatgcagtgcgatgccgcgcagaccgctgccgccaacgccggactccaggccgagtgc
gtggtgggcaacaccatcgctcccaacgcgaaccaggtcggcacggtcgagtccgtgcag
cccggcggcaacgttcccgagggcacggccatcacgctgacgaccttcaaggagcaggtg
aaggtgggcaagccctcgggcaccccgaccatcgccggcaccgccaccgagggcgagccc
gtgaccctcaactggccgagcttcgagtgcccctcgggcaccccggcgcgatcggcgttc
gaggtgacgctcaccaacgcgacgttctccggcggcaacgccggcgagtccatccgcagc
ttcggacccagcgtgctctcgacgcagatcgtccccggcacggccggacagtcgatcacc
gccacgttccgcgtcttctgcggcagcgacatgccgtccgagcagtcggatgccatgccg
ggcgtcgtcatcctgcccgccgcgccgggcgccgatgaaggcgacgcagacggcggagac
tcaggcgaataa

DBGET integrated database retrieval system