KEGG   Microbacterium sp. CGR1: AKG07_12910Help
Entry
AKG07_12910       CDS       T04046                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
mim  Microbacterium sp. CGR1
Brite
KEGG Orthology (KO) [BR:mim00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AKG07_12910
Enzymes [BR:mim01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     AKG07_12910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C NAD_binding_7 2-Hacid_dh_C ADH_N_2 Shikimate_DH ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AKV87043
LinkDB All DBs
Position
complement(2653884..2654888)
Genome map
AA seq 334 aa AA seqDB search
MKALAIHGKEDIRWEDREVPTPGDGEVRLRVNFVGICGSDLHYYFHGANGEYTIREPLTP
GHELSGVVDLDPSGRLEPGTPVTVHPARYGAEVPGLEGHPHLRPGGDYFGSAAANPHRQG
GASELLIVEDHMLRVLPASLPLERAALAEPLAVAIHAVSLAGDITGKRVLVIGAGPIGLL
VVAAALHAGAAVVGASDVREEPLDRATSLGATEVSLVGRDTIENESYDIVFECSGVGVAL
TQAVRAARRVGTIVQVGMLPNADIGVNLAPMLAKELTIRGAFRFSTEIDDAVALLAESDA
LDSVISHVLPASDAVQAFELARDSSASAKVLLAL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcgccatccacggcaaggaagacatccgctgggaggaccgcgaggtcccg
acccccggcgacggcgaggtccgcctccgcgtgaacttcgtcggcatctgcggctccgac
ctgcactactacttccacggagcgaacggcgagtacacgatccgcgagccgctcaccccc
ggccatgagctgtcgggtgtcgtcgacctcgacccgtccggccgcctggaacccggcacc
cccgtcaccgtgcaccccgcgcgctacggtgccgaggtccccgggctcgaaggccacccg
catctgcgtcccggcggcgactacttcggcagcgccgccgcgaacccccaccgccagggc
ggggcatccgagctgctgatcgtcgaagaccacatgctgcgcgtgctccccgcatccctt
ccgctcgagcgcgcagccctcgccgagccgctggccgtggcgatccacgccgtgagcctc
gccggagacatcaccggcaagcgggtgctcgtgatcggcgcggggcccatcggactcctc
gtcgtcgctgcggcactccacgcgggcgccgcggtggtcggcgcgagcgacgtgcgtgaa
gagcctctcgaccgggcgacgtccctcggcgcgaccgaggtctcgctcgtcggtcgcgac
accatcgagaacgagtcctacgacatcgtgttcgaatgctccggcgtcggagtggccctc
acccaggcggtgcgcgcggcccgccgcgtcggcaccatcgtgcaggtcgggatgctgccg
aacgccgacatcggagtgaacctcgcgccgatgctcgccaaggagctcaccatccgcggc
gccttccgcttctcgaccgagatcgacgacgcggtcgcgctgctggccgagtccgatgcc
ctcgactccgtcatctcgcacgtcctcccggcatccgacgccgtccaggccttcgaactc
gctcgcgactcgtccgcctcggcgaaggtcctgctggccctctag

DBGET integrated database retrieval system