KEGG   Microbacterium sp. CGR1: AKG07_14025Help
Entry
AKG07_14025       CDS       T04046                                 

Definition
(GenBank) cystathionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
mim  Microbacterium sp. CGR1
Pathway
mim00270  Cysteine and methionine metabolism
mim00450  Selenocompound metabolism
mim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mim00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AKG07_14025
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AKG07_14025
Enzymes [BR:mim01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     AKG07_14025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 Met_gamma_lyase Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AKV88167
LinkDB All DBs
Position
complement(2900058..2901272)
Genome map
AA seq 404 aa AA seqDB search
MSARPDRKDLHTLSDLSLAVHGGNQLDSTLALRTPLVMANSYQLPDDPSEISWSATAPGL
YTRNTGVNQAALEQKLAALDGAEDAVALASGVAALHAVFFTHVRAGDHVVVSDVVYEATW
RLWTELLPQRYGLDASFVDISDLDAVRAAMRPETRLVCIEAIANPTTKVADVSAVAEIAH
SAGAILMVDSTFSPPPFYRPIHDGADLVVHSLTKYLNGHGDAMGGSVSGRRDLIQAIKAD
AMVDVGGIISPFNAWQIQRGTVTLPLRLRQHFSSALQIAQMLEADTRVEYIYYPGLESHP
DHALAVRQFGGRGFGGMMAFAVTGSPDVQNRFVANLRLITSGFSLGHDDSLIVHTGTEGG
RVATYPAPFREFGHLRLSVGLEDADDLLADLSAALDLTFGSASR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcgacccgaccgcaaggatctgcacacgctgtccgacctgagcttggccgtg
cacgggggcaatcagctcgattcgaccctggcgctgcgcactcccctcgtgatggccaac
tcgtaccagctgcccgacgacccgagcgagatcagctggtcggcgactgcgccggggctc
tacacccgcaacacgggagtcaatcaggccgcactcgagcagaagctcgccgcgctcgat
ggagccgaggacgcggtcgccctcgcttccggagtcgccgccctgcacgcggtgttcttc
actcatgtgcgcgccggcgaccacgtcgtcgtgagcgacgtggtctatgaggccacgtgg
cgcctgtggacagagctgctgccccagcgctacgggctcgacgccagcttcgtcgacatc
agcgacctcgacgcggtgcgggcggccatgcgccccgagacgcgtctcgtgtgcatcgag
gccatcgcgaatccgaccaccaaggtcgccgatgtgagcgcggtcgccgagatcgcccac
tccgccggcgccatcctcatggtcgactcgacgttctcgccgccgccgttctaccgaccg
atccacgacggcgccgacctggtggtgcactccctcaccaagtacctcaacggccacggc
gacgccatggggggctcggtctccggccggcgcgatctcatccaggcgatcaaagccgac
gccatggtcgacgtcggcggcatcatctcgcccttcaacgcgtggcagatccagcgcggc
accgtcaccctgccgctgcgcctgcgccagcacttctcgtcggcgctgcagatcgcgcag
atgctcgaagccgacacgcgggtcgagtacatctactacccgggtctcgaatcgcatccg
gaccacgccctcgccgtgcggcagttcggcggacgcggcttcggaggcatgatggccttc
gccgtcacgggctcccccgacgtgcagaaccgcttcgtcgcgaacctgcgactcatcacc
tccgggttctcactcggccacgacgactcgctcatcgtgcacacgggcaccgagggcggc
cgtgtcgccacctatccggcacccttccgagagttcggacacctgcgtctgtccgtcggc
ctcgaagatgccgacgacctcctcgccgacctctccgccgctctcgatctcaccttcggc
agcgcttcgcggtag

DBGET integrated database retrieval system